Cathepsin L Antibody - BSA Free

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil

Staining of human cell line A549 shows localization to the Golgi apparatus & vesicles.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cathepsin L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GIASATLTFDHSLEAQWTKWKAMHNRLYGM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTSL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cathepsin L Antibody - BSA Free

• Cathepsin L
• cathepsin L1
• CATL
• CTSL
• CTSL1
• CTSLEC 3.4.22.15
• EC 3.4.22
• FLJ31037
• Major excreted protein
• MEP

Background

Cathepsins are lysosomal proteases that play an important role in the intracellular degradation of exogenous and endogenous proteins, activation of enzyme precursors, and tumour invasion and metastasis. Normally located in lysosomes of almost all mammalian cells, they can be secreted from the cell under certain conditions. Cathepsin L is responsible for most of the intralysosomal breakdown of normal cells. Cathepsin L is secreted by numerous transformed cells in its inactive proform, and mRNA expression level seems to correlate with their metastatic potential.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTSL