Cathepsin A/Lysosomal Carboxypeptidase A Antibody

Images

 
Western Blot: Cathepsin A/Lysosomal Carboxypeptidase A Antibody [NBP1-89728] - Analysis in human cell line U-87 MG.
Immunocytochemistry/ Immunofluorescence: Cathepsin A/Lysosomal Carboxypeptidase A Antibody [NBP1-89728] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Cathepsin A/Lysosomal Carboxypeptidase A Antibody [NBP1-89728] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cathepsin A/Lysosomal Carboxypeptidase A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTSA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cathepsin A/Lysosomal Carboxypeptidase A Protein (NBP1-89728PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cathepsin A/Lysosomal Carboxypeptidase A Antibody

  • beta-galactosidase 2
  • beta-galactosidase protective protein
  • Carboxypeptidase C
  • Carboxypeptidase L
  • Cathepsin A
  • cathepsin ANGBE
  • CTSA
  • EC 3.4.16
  • EC 3.4.16.5
  • GLB2
  • GSL
  • Lysosomal Carboxypeptidase A
  • lysosomal protective protein
  • PPCA
  • PPGBprotective protein for beta-galactosidase (galactosialidosis)
  • Protective protein cathepsin A
  • Protective protein for beta-galactosidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6860
Species: Hu
Applications: WB, IP
H00007357-M03
Species: Hu
Applications: WB, ELISA
AF3638
Species: Hu
Applications: WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
AF1396
Species: Hu
Applications: WB
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-59448
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF

Publications for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728) (0)

There are no publications for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728) (0)

There are no reviews for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin A/Lysosomal Carboxypeptidase A Products

Bioinformatics Tool for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728)

Discover related pathways, diseases and genes to Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728)

Discover more about diseases related to Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728).
 

Pathways for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728)

View related products by pathway.

PTMs for Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728)

Learn more about PTMs related to Cathepsin A/Lysosomal Carboxypeptidase A Antibody (NBP1-89728).

Blogs on Cathepsin A/Lysosomal Carboxypeptidase A

There are no specific blogs for Cathepsin A/Lysosomal Carboxypeptidase A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin A/Lysosomal Carboxypeptidase A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSA
Entrez
Uniprot