Carnosine Dipeptidase 1/CNDP1 Antibody

Images

 
Immunohistochemistry-Paraffin: CNDP1 Antibody [NBP1-85528] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carnosine Dipeptidase 1/CNDP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNDP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carnosine Dipeptidase 1/CNDP1 Protein (NBP1-85528PEP)
Publications
Read Publications using NBP1-85528.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%). Reactivity reported in scientific literature (PMID: 21898641)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Carnosine Dipeptidase 1/CNDP1 Antibody

  • beta-Ala-His dipeptidase
  • Carnosinase 1
  • carnosine dipeptidase 1 (metallopeptidase M20 family)
  • Carnosine Dipeptidase 1
  • CN1MGC102737
  • CNDP dipeptidase 1
  • CNDP1
  • CPGL2
  • CPGL2MGC142072
  • EC 3.4.13.20
  • Glutamate carboxypeptidase-like protein 2
  • HsT2308
  • MGC10825
  • Serum carnosinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00953
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NB100-875
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IP, PEP-ELISA
AF5866
Species: Hu
Applications: WB, IHC
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
AF5346
Species: Hu
Applications: WB
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-85528
Species: Hu
Applications: IHC, IHC-P

Publications for Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528)(6)

Reviews for Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528) (0)

There are no reviews for Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carnosine Dipeptidase 1/CNDP1 Products

Bioinformatics Tool for Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528)

Discover related pathways, diseases and genes to Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528)

Discover more about diseases related to Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528).
 

Pathways for Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528)

View related products by pathway.

PTMs for Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528)

Learn more about PTMs related to Carnosine Dipeptidase 1/CNDP1 Antibody (NBP1-85528).

Blogs on Carnosine Dipeptidase 1/CNDP1

There are no specific blogs for Carnosine Dipeptidase 1/CNDP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carnosine Dipeptidase 1/CNDP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNDP1
Entrez