CARKL Antibody - BSA Free

Western Blot: CARKL Antibody [NBP1-91151] - Analysis in control (vector only transfected HEK293T lysate) and SHPK over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: CARKL Antibody [NBP1-91151] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: CARKL Antibody [NBP1-91151] - Staining of human pancreas shows low expression as expected.

Analysis in control (vector only transfected HEK293T lysate) and SHPK over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Analysis in human kidney and pancreas tissues using Anti-SHPK antibody. Corresponding SHPK RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CARKL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CARKL Antibody - BSA Free (NBP1-91151) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FLKSYDAAGTIHDYVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMWFEIPKGTQV
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHPK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CARKL Protein (NBP1-91151PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CARKL Antibody - BSA Free

• Carbohydrate kinase-like protein
• carbohydrate kinase-like
• CARKLEC 2.7.1.14
• sedoheptulokinase
• SHKFLJ32478

Background

CARKL is encoded by this gene has weak homology to several carbohydrate kinases, a class of proteins involved in the phosphorylation of sugars as they enter a cell, inhibiting return across the cell membrane. Sequence variation between this novel gene and known carbohydrate kinases suggests the possibility of a different substrate, cofactor or changes in kinetic properties distinguishing it from other carbohydrate kinases. The gene resides in a region commonly deleted in cystinosis patients, suggesting a role as a modifier for the cystinosis phenotype. The genomic region is also rich in Alu repetitive sequences, frequently involved in chromosomal rearrangements. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SHPK