CTNS Antibody (5G6)

Images

 
Western Blot: CTNS Antibody (5G6) [H00001497-M09] - Analysis of CTNS expression in Raw 264.7.
Western Blot: CTNS Antibody (5G6) [H00001497-M09] - Analysis of CTNS expression in PC-12.
Western Blot: CTNS Antibody (5G6) [H00001497-M09] - Analysis of CTNS expression in HepG2.
Western Blot: CTNS Antibody (5G6) [H00001497-M09] - Analysis of CTNS expression in human liver.
ELISA: CTNS Antibody (5G6) [H00001497-M09] - Detection limit for recombinant GST tagged CTNS is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
5G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CTNS Antibody (5G6) Summary

Immunogen
CTNS (NP_004928, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY
Specificity
CTNS - cystinosis, nephropathic
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTNS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00001497-M09.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CTNS Antibody (5G6)

  • CTNS-LSB
  • cystinosin
  • cystinosis, nephropathic
  • PQLC4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91151
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-84570
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-34085
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38016
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00001497-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for CTNS Antibody (H00001497-M09)(2)

Reviews for CTNS Antibody (H00001497-M09) (0)

There are no reviews for CTNS Antibody (H00001497-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTNS Antibody (H00001497-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTNS Products

Bioinformatics Tool for CTNS Antibody (H00001497-M09)

Discover related pathways, diseases and genes to CTNS Antibody (H00001497-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTNS Antibody (H00001497-M09)

Discover more about diseases related to CTNS Antibody (H00001497-M09).
 

Pathways for CTNS Antibody (H00001497-M09)

View related products by pathway.

PTMs for CTNS Antibody (H00001497-M09)

Learn more about PTMs related to CTNS Antibody (H00001497-M09).
 

Research Areas for CTNS Antibody (H00001497-M09)

Find related products by research area.

Blogs on CTNS

There are no specific blogs for CTNS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTNS Antibody (5G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNS
Entrez
OMIM
Uniprot