ARSK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARSK Antibody [NBP1-84209] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles.
Immunohistochemistry-Paraffin: ARSK Antibody [NBP1-84209] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARSK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:WSPLSEMHPVDYYSSYTKNCTGRFTKKEIKNIRAFYYAMCAETDAMLGEIILALHQLDLLQKTIVIYSSDHGELAMEHRQFYKMSMYEASAHVPLLMMGPGIKAGLQVSNVVSLVDIYPTMLDIAGIPLPQNLSGYSLLPLSSETFKNE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARSK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARSK Protein (NBP1-84209PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARSK Antibody

  • arylsulfatase family, member K
  • arylsulfatase K
  • ASK
  • EC 3.1.6
  • EC 3.1.6.-
  • Telethon sulfatase
  • TSULFDKFZp313G1735

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB120-10535
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00010926-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14219
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ARSK Antibody (NBP1-84209) (0)

There are no publications for ARSK Antibody (NBP1-84209).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARSK Antibody (NBP1-84209) (0)

There are no reviews for ARSK Antibody (NBP1-84209). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARSK Antibody (NBP1-84209) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARSK Products

Bioinformatics Tool for ARSK Antibody (NBP1-84209)

Discover related pathways, diseases and genes to ARSK Antibody (NBP1-84209). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARSK Antibody (NBP1-84209)

Discover more about diseases related to ARSK Antibody (NBP1-84209).

Research Areas for ARSK Antibody (NBP1-84209)

Find related products by research area.

Blogs on ARSK

There are no specific blogs for ARSK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARSK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARSK
Entrez
Uniprot