Carbonic Anhydrase XII/CA12 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Carbonic Anhydrase XII/CA12 Antibody [NBP2-57791] - Staining of human cell line A549 shows localization to nucleoplasm & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Carbonic Anhydrase XII/CA12 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CA12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Carbonic Anhydrase XII/CA12 Recombinant Protein Antigen (NBP2-57791PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Carbonic Anhydrase XII/CA12 Antibody - BSA Free

• CA12
• Carbonate dehydratase XII
• carbonic anhydrase 12
• Carbonic Anhydrase XII
• carbonic anhydrase XIICAXII
• carbonic dehydratase
• CA-XII
• EC 4.2.1.1
• FLJ20151
• HsT18816
• Tumor antigen HOM-RCC-3.1.3

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CA12