Carbonic Anhydrase XII/CA12 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Carbonic Anhydrase XII/CA12 Antibody [NBP1-81668] - Staining of human cell line RT4 shows localization to nucleus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Carbonic Anhydrase XII/CA12 Antibody [NBP1-81668] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Carbonic Anhydrase XII/CA12 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CA12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in (PMID: 26911677).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Carbonic Anhydrase XII/CA12 Protein (NBP1-81668PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%). Reactivity reported in scientific literature (PMID: 22016510)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Carbonic Anhydrase XII/CA12 Antibody - BSA Free

• CA12
• Carbonate dehydratase XII
• carbonic anhydrase 12
• Carbonic Anhydrase XII
• carbonic anhydrase XIICAXII
• carbonic dehydratase
• CA-XII
• EC 4.2.1.1
• FLJ20151
• HsT18816
• Tumor antigen HOM-RCC-3.1.3

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Carbonic Anhydrase XII/CA12 Antibody (NBP1-81668)(5)

Publications using NBP1-81668

• Lee M, Vecchio-Pagan B, Sharma N et al. Loss of carbonic anhydrase XII function in individuals with elevated sweat chloride concentration and pulmonary airway disease Hum. Mol. Genet. 2016-02-23 [PMID: 26911677] (IHC-P, WB, Human)
• Vermeulen JF, Kornegoor R, van der Wall E et al. Differential expression of growth factor receptors and membrane-bound tumor markers for imaging in male and female breast cancer. PLoS One. 2013-01-04 [PMID: 23308200] (IF/IHC)
• Vermeulen JF, van Brussel AS, van der Groep P et al. Immunophenotyping invasive breast cancer: paving the road for molecular imaging. BMC Cancer 2012-06-01 [PMID: 22695343]
• Tafreshi NK, Bui MM, Bishop K et al. Noninvasive detection of breast cancer lymph node metastasis using carbonic anhydrases IX and XII targeted imaging probes. Clin Cancer Res 2012-01-01 [PMID: 22016510]
• Davidson B, Stavnes HT, Holth A et al. Gene expression signatures differentiate ovarian/peritoneal serous carcinoma from breast carcinoma in effusions. J Cell Mol Med 2011-03-01 [PMID: 20132413]

Bioinformatics

• Gene Symbol: CA12