Carbonic Anhydrase III/CA3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228] - Staining in human skeletal muscle and skin tissues using anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88228] - Staining of human skin shows low expression as expected.

Analysis using Anti-CA3 antibody NBP1-88228 (A) shows similar pattern to independent antibody NBP1-88227 (B).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Carbonic Anhydrase III/CA3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Carbonic Anhydrase III/CA3 Antibody - BSA Free (NBP1-88228) is a polyclonal antibody validated for use in IHC and WB. Anti-Carbonic Anhydrase III/CA3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Carbonic Anhydrase III/CA3 Protein (NBP1-88228PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%). Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Carbonic Anhydrase III/CA3 Antibody - BSA Free

• CA3
• CAIII
• CA-III
• Car3
• Carbonate dehydratase III
• carbonic anhydrase 3
• Carbonic Anhydrase III
• carbonic anhydrase III, muscle specific
• EC 4.2.1.1

Background

Carbonic anhydrase III (CAIII) is a member of a multigene family (at least six separate genes are known) that encode carbonic anhydrase isozymes. These carbonic anhydrases are a class of metalloenzymes that catalyze the reversible hydration of carbon dioxide and are differentially expressed in a number of cell types. The expression of the CA3 gene is strictly tissue specific and present at high levels in skeletal muscle and much lower levels in cardiac and smooth muscle. A proportion of carriers of Duchenne muscle dystrophy have a higher CA3 level than normal. The gene spans 10.3 kb and contains seven exons and six introns.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Carbonic Anhydrase III/CA3 Antibody (NBP1-88228)(1)

Publication using NBP1-88228

• Bachmann J, Burte F, Pramana S et al. Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria. PLoS Pathog 2014-04-01 [PMID: 24743550]

Bioinformatics

• Gene Symbol: CA3