Carbonic Anhydrase III/CA3 Antibody


Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Staining in human skeletal muscle and heart muscle tissues using anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the more
Western Blot: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression more
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Carbonic Anhydrase III/CA3 Antibody [NBP1-88227] - Staining of human skeletal muscle shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Carbonic Anhydrase III/CA3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Specificity of human Carbonic Anhydrase III/CA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Carbonic Anhydrase III/CA3 Protein (NBP1-88227PEP)
Read Publication using NBP1-88227.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Carbonic Anhydrase III/CA3 Antibody

  • CA3
  • CA-III
  • Car3
  • Carbonate dehydratase III
  • carbonic anhydrase 3
  • Carbonic Anhydrase III
  • carbonic anhydrase III, muscle specific
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227)(1)

Reviews for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227) (0)

There are no reviews for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Carbonic Anhydrase III/CA3 Products

Bioinformatics Tool for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227)

Discover related pathways, diseases and genes to Carbonic Anhydrase III/CA3 Antibody (NBP1-88227). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227)

Discover more about diseases related to Carbonic Anhydrase III/CA3 Antibody (NBP1-88227).

Pathways for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227)

View related products by pathway.

PTMs for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227)

Learn more about PTMs related to Carbonic Anhydrase III/CA3 Antibody (NBP1-88227).

Research Areas for Carbonic Anhydrase III/CA3 Antibody (NBP1-88227)

Find related products by research area.

Blogs on Carbonic Anhydrase III/CA3

There are no specific blogs for Carbonic Anhydrase III/CA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Carbonic Anhydrase III/CA3 Antibody and receive a gift card or discount.


Gene Symbol CA3