CAPRIN2 Antibody - BSA Free

Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CAPRIN2 Antibody - BSA Free Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CAPRIN2 using the following amino acid sequence: SSPNFILNFPPPPSASSVSMVQLFSSPFGYQSPSGHSEEEREGNMKSAKPQVNHSQHGESQRALSPLQSTLSSAASPSQAYETYIENGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPRIN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, we recommend using Heat-Induced Epitope Retrieval (HIER) with a pH level of 6. This optimized retrieval method ensures the best results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CAPRIN2 Antibody - BSA Free

• caprin family member 2
• FLJ22569
• RNA granule protein 140

Background

CAPRIN2 is involved in regulation of growth as erythroblasts shift from a highly proliferative state towards theirterminal phase of differentiation. Overexpression is associated with increased levels of apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPRIN2