CAPRIN2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CAPRIN2 Antibody [NBP1-88318] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & centrosome.
Immunohistochemistry: CAPRIN2 Antibody [NBP1-88318] - Staining of human hippocampus shows strong cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAPRIN2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TPKPRENNVESQKHSLTSQSQISPKSWGVATASLIPNDQLLPRKLNTEPKDVPKPVHQPVGSSSTLPKDPVLRKEKLQDLMTQIQGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAPRIN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAPRIN2 Protein (NBP1-88318PEP)
Publications
Read Publications using
NBP1-88318 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25634356).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAPRIN2 Antibody

  • caprin family member 2
  • FLJ22569
  • RNA granule protein 140

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22238
Species: Hu, Mu
Applications: WB, IP
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87331
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3287
Species: Hu, Mu, Rt
Applications: WB
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
H00000712-P01
Species: Hu
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
366-6C/CF
Species: Hu
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88318
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CAPRIN2 Antibody (NBP1-88318)(2)

Reviews for CAPRIN2 Antibody (NBP1-88318) (0)

There are no reviews for CAPRIN2 Antibody (NBP1-88318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CAPRIN2 Antibody (NBP1-88318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAPRIN2 Products

CAPRIN2 NBP1-88318

Bioinformatics Tool for CAPRIN2 Antibody (NBP1-88318)

Discover related pathways, diseases and genes to CAPRIN2 Antibody (NBP1-88318). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAPRIN2 Antibody (NBP1-88318)

Discover more about diseases related to CAPRIN2 Antibody (NBP1-88318).
 

Pathways for CAPRIN2 Antibody (NBP1-88318)

View related products by pathway.

PTMs for CAPRIN2 Antibody (NBP1-88318)

Learn more about PTMs related to CAPRIN2 Antibody (NBP1-88318).

Blogs on CAPRIN2

There are no specific blogs for CAPRIN2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAPRIN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPRIN2