CAP1 Antibody - BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CAP1 (NP_006358.1).
Sequence: MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLKISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CAP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for CAP1 Antibody - BSA Free
Background
CAP1 is encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin. Alternatively spliced transcript variants have been identified. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, In, Mu, Pm, Rt
Applications: ICC/IF, IF, IHC (-), WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Publications for CAP1 Antibody (NBP3-35444) (0)
There are no publications for CAP1 Antibody (NBP3-35444).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CAP1 Antibody (NBP3-35444) (0)
There are no reviews for CAP1 Antibody (NBP3-35444).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CAP1 Antibody (NBP3-35444) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CAP1 Products
Research Areas for CAP1 Antibody (NBP3-35444)
Find related products by research area.
|
Blogs on CAP1