CAP2 Antibody

Images

 
Western Blot: CAP2 Antibody [NBP2-30572] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CAP2 Antibody [NBP2-30572] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry: CAP2 Antibody [NBP2-30572] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAP2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTQSPTKSHTPSPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAP2 Protein (NBP2-30572PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAP2 Antibody

  • 2810452G09Rik
  • adenylyl cyclase-associated protein 2
  • CAP 2
  • CAP, adenylate cyclase-associated protein, 2 (yeast)
  • PI8
  • SERPINB8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF6386
Species: Hu
Applications: WB, IP
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
NBL1-14964
Species: Hu
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NB100-58965
Species: Hu
Applications: WB, PEP-ELISA
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-12553
Species: Hu
AF2119
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24696
Species: Hu
Applications: IHC-P
NBP1-83046
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56991
Species: Hu
Applications: WB

Publications for CAP2 Antibody (NBP2-30572) (0)

There are no publications for CAP2 Antibody (NBP2-30572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAP2 Antibody (NBP2-30572) (0)

There are no reviews for CAP2 Antibody (NBP2-30572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CAP2 Antibody (NBP2-30572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAP2 Products

Bioinformatics Tool for CAP2 Antibody (NBP2-30572)

Discover related pathways, diseases and genes to CAP2 Antibody (NBP2-30572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAP2 Antibody (NBP2-30572)

Discover more about diseases related to CAP2 Antibody (NBP2-30572).
 

Pathways for CAP2 Antibody (NBP2-30572)

View related products by pathway.

PTMs for CAP2 Antibody (NBP2-30572)

Learn more about PTMs related to CAP2 Antibody (NBP2-30572).

Blogs on CAP2

There are no specific blogs for CAP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAP2
Uniprot