![Western Blot: Calreticulin Antibody [NBP2-48491] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/Calreticulin-Antibody-Western-Blot-NBP2-48491-img0005.jpg "Western Blot: Calreticulin Antibody [NBP2-48491] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDS |
| Specificity | Specificity of human, mouse, rat Calreticulin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CALR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for Calreticulin Antibody (NBP2-48491)Discover more about diseases related to Calreticulin Antibody (NBP2-48491).
| Pathways for Calreticulin Antibody (NBP2-48491)View related products by pathway.
|
|
Calreticulin - ER chaperone involved in calcium homeostasis and protein quality control Calreticulin is a calcium-dependent ER chaperone, involved in protein folding, maturation, and cellular localization. Calreticulin is a highly conserved 48 kDa protein encoded by the CALR gene. Calreticulin and its homolog calnexin regulate the fo... Read full blog post. |
|
Calnexin - an ER chaperone that folds the cell's glycoproteins Calnexin is an abundant 90kDa chaperone protein that resides in the membrane of the endoplasmic reticulum. Calnexin and the related calreticulin protein function together to ensure the proper folding of glycoproteins. By binding to partially folded... Read full blog post. |
|
Calreticulin: a Multiprocess Calcium Buffering Chaperone Calreticulin is a Calcium binding chaperone that has multiple functions both inside and outside the endoplasmic reticulum. Calreticulin is involved in the quality control of newly synthesized proteins and glycoproteins, interacting with various other... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CALR |
![Immunohistochemistry-Paraffin: Calreticulin Antibody [NBP2-48491] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize2/Calreticulin-Antibody-Immunohistochemistry-Paraffin-NBP2-48491-img0006.jpg "Immunohistochemistry-Paraffin: Calreticulin Antibody [NBP2-48491] - Staining of human pancreas shows low expression as expected.")
![Western Blot: Calreticulin Antibody [NBP2-48491] - Analysis in human cell line HL-60.](http://images.novusbio.com/fullsize2/Calreticulin-Antibody-Western-Blot-NBP2-48491-img0004.jpg "Western Blot: Calreticulin Antibody [NBP2-48491] - Analysis in human cell line HL-60.")
![Immunohistochemistry: Calreticulin Antibody [NBP2-48491] - Staining of human thyroid gland shows strong cytoplasmic positivity.](http://images.novusbio.com/fullsize2/Calreticulin-Antibody-Immunohistochemistry-NBP2-48491-img0001.jpg "Immunohistochemistry: Calreticulin Antibody [NBP2-48491] - Staining of human thyroid gland shows strong cytoplasmic positivity.")
![Immunohistochemistry-Paraffin: Calreticulin Antibody [NBP2-48491] - Staining in human thyroid gland and pancreas tissues using anti-CALR antibody. Corresponding CALR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Calreticulin Antibody-Immunohistochemistry-Paraffin-NBP2-48491-img0007.jpg "Immunohistochemistry-Paraffin: Calreticulin Antibody [NBP2-48491] - Staining in human thyroid gland and pancreas tissues using anti-CALR antibody. Corresponding CALR RNA-seq data are presented for the same tissues.")
![Western Blot: SSB Antibody (2C8) [NBP1-48002] Analysis of extracts (35ug) from 9 different cell lines by using anti-SSB monoclonal antibody.](http://images.novusbio.com/fullsize/SSB Antibody (2C8)-Western Blot-NBP1-48002-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: SSB Antibody (2C8) [NBP1-48002] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SSB.](http://images.novusbio.com/fullsize/SSB Antibody (2C8)-Immunocytochemistry-Immunofluorescence-NBP1-48002-img0013.jpg)
![Immunohistochemistry-Paraffin: SSB Antibody (2C8) [NBP1-48002] - Staining of paraffin-embedded Human prostate tissue using anti-SSB mouse monoclonal antibody.](http://images.novusbio.com/fullsize/SSB Antibody (2C8)-Immunohistochemistry-Paraffin-NBP1-48002-img0012.jpg)
![Western Blot: TROVE2 Antibody [NBP1-86998] - Analysis in human cell line K562.](http://images.novusbio.com/fullsize2/TROVE2-Antibody-Western-Blot-NBP1-86998-img0003.jpg)
![Immunohistochemistry-Paraffin: TROVE2 Antibody [NBP1-86998] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/TROVE2-Antibody-Immunohistochemistry-Paraffin-NBP1-86998-img0002.jpg)
![Western Blot: TRIM21/SSA1 Antibody [NBP1-87122] - Analysis in control (vector only transfected HEK293T lysate) and TRIM21 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/TRIM21-SSA1-Antibody-Western-Blot-NBP1-87122-img0015.jpg)
![Immunocytochemistry/Immunofluorescence: TRIM21/SSA1 Antibody [NBP1-87122] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/TRIM21-SSA1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87122-img0006.jpg)
![Immunohistochemistry-Paraffin: TRIM21/SSA1 Antibody [NBP1-87122] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize2/TRIM21-SSA1-Antibody-Immunohistochemistry-Paraffin-NBP1-87122-img0012.jpg)
![Western Blot: Calnexin Antibody [NB100-1965] - A dilution of 1/2000 used in TBS with 0.05% Tween-20. Bands visualized by ECL using goat anti-rabbit HRP at 1:2000.](http://images.novusbio.com/fullsize2/Calnexin-Antibody-Western-Blot-NB100-1965-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Calnexin Antibody [NB100-1965] - Antibody was tested at 1:50 in HeLa cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).](http://images.novusbio.com/fullsize2/Calnexin-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1965-img0009.jpg)
![Immunohistochemistry: Calnexin Antibody [NB100-1965] - IHC analysis of CANX in mouse prostate using DAB with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/Calnexin-Antibody-Immunohistochemistry-NB100-1965-img0010.jpg)
![Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.](http://images.novusbio.com/fullsize2/PRRT2-Antibody-Immunohistochemistry-Paraffin-NBP1-84168-img0011.jpg)
![Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human cerebellum shows strong positivity in neuropil.](http://images.novusbio.com/fullsize2/PRRT2-Antibody-Immunohistochemistry-Paraffin-NBP1-84168-img0009.jpg)
![Immunohistochemistry-Paraffin: PRRT2 Antibody [NBP1-84168] - Immunohistochemical staining of human pancreas shows no positivity as expected.](http://images.novusbio.com/fullsize2/PRRT2-Antibody-Immunohistochemistry-Paraffin-NBP1-84168-img0010.jpg)
![Western Blot: GRP78/HSPA5 Antibody [NBP1-06274] - Total protein from human HeLa and A431 cells, mouse 3T3 cells and rat PC12 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-GPR78 in blocking buffer and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/fullsize2/GRP78-HSPA5-Antibody-Western-Blot-NBP1-06274-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: GRP78/HSPA5 Antibody [NBP1-06274] - NIH-3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-GRP78/HSPA5 at 2 ug/mL overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/GRP78-HSPA5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-06274-img0013.jpg)
![Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on NIH3T3 cells with GRP78/HSPA5 Antibody NBP1-06274AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.](http://images.novusbio.com/fullsize2/GRP78-HSPA5-Antibody-Flow-Cytometry-NBP1-06274-img0014.jpg)
![Western Blot: ERp57/PDIA3 Antibody [NBP1-84796] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented](http://images.novusbio.com/fullsize2/ERp57-PDIA3-Antibody-Western-Blot-NBP1-84796-img0017.jpg)
![Immunocytochemistry/Immunofluorescence: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/ERp57-PDIA3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84796-img0009.jpg)
![Immunohistochemistry-Paraffin: ERp57/PDIA3 Antibody [NBP1-84796] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize2/ERp57-PDIA3-Antibody-Immunohistochemistry-Paraffin-NBP1-84796-img0016.jpg)
![Western Blot: POMT1 Antibody [NBP1-60054] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/POMT1 Antibody-Western Blot-NBP1-60054-img0002.jpg)
![Western Blot: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - Analysis of 25 ug of Hela (lane 1), C6 (lane 2) and NIH-3T3 (lane 3) lysates.](http://images.novusbio.com/fullsize2/gp96-HSP90B1-GRP94-Antibody-(9G10)-Western-Blot-NB300-619-img0029.jpg)
![Immunocytochemistry/Immunofluorescence: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - Analysis of Glucose-Regulated Protein 94 using Glucose-Regulated Protein 94 Monoclonal Antibody (9G10) shows staining in NIH-3T3 Cells. Glucose-Regulated Protein 94 (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucose-Regulated Protein 94 at a dilution of 1:20 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.](http://images.novusbio.com/fullsize2/gp96-HSP90B1-GRP94-Antibody-(9G10)-Immunocytochemistry-Immunofluorescence-NB300-619-img0019.jpg)
![Immunohistochemistry-Paraffin: gp96/HSP90B1/GRP94 Antibody (9G10) [NB300-619] - Normal biopsies of deparaffinized Mouse breast tissue.](http://images.novusbio.com/fullsize2/gp96-HSP90B1-GRP94-Antibody-(9G10)-Immunohistochemistry-Paraffin-NB300-619-img0028.jpg)
![Western Blot: RNPC3 Antibody [NBP1-57138] - Human Spleen lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/RNPC3 Antibody-Western Blot-NBP1-57138-img0002.jpg)
![Western Blot: CD77 Synthase Antibody [NBP1-90824] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402588)](http://images.novusbio.com/fullsize2/CD77-Synthase-Antibody-Western-Blot-NBP1-90824-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP1-90824] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/CD77-Synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90824-img0006.jpg)
![Western Blot: MID1 Antibody [NBP1-26612] - Whole cell lysate from HeLa (5, 15 and 50 ug) and 293T (T; 50 ug) cells. Antibody used at 1 ug/ml.](http://images.novusbio.com/fullsize2/MID1-Antibody-Western-Blot-NBP1-26612-img0002.jpg)
![SDS-Page: Recombinant Human PRH2 Protein [H00005555-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00005555-P01-1.jpg)
![Western Blot: ZAK Antibody (3G5) [H00051776-M03] - ZAK monoclonal antibody (M03), clone 3G5. Western Blot analysis of ZAK expression in human stomach.](http://images.novusbio.com/fullsize2/ZAK-Antibody-(3G5)-Western-Blot-H00051776-M03-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: ZAK Antibody (3G5) [H00051776-M03] - Analysis of monoclonal antibody to ZAK on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize2/ZAK-Antibody-(3G5)-Immunocytochemistry-Immunofluorescence-H00051776-M03-img0004.jpg)
![Immunohistochemistry-Paraffin: ZAK Antibody (3G5) [H00051776-M03] - Analysis of monoclonal antibody to ZAK on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize2/ZAK Antibody (3G5)-Immunohistochemistry-Paraffin-H00051776-M03-img0006.jpg)
![Western Blot: SEC14L2 Antibody (4H2) [NBP2-01346] Analysis of extracts (35ug) from 9 different cell lines by using anti-SEC14L2 monoclonal antibody.](http://images.novusbio.com/fullsize/SEC14L2 Antibody (4H2)-Western Blot-NBP2-01346-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: SEC14L2 Antibody (4H2) [NBP2-01346] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY SEC14L2.](http://images.novusbio.com/fullsize/SEC14L2 Antibody (4H2)-Immunocytochemistry-Immunofluorescence-NBP2-01346-img0005.jpg)
![Immunohistochemistry-Paraffin: SEC14L2 Antibody (4H2) [NBP2-01346] - Staining of paraffin-embedded Human prostate tissue using anti-SEC14L2 mouse monoclonal antibody.](http://images.novusbio.com/fullsize/SEC14L2 Antibody (4H2)-Immunohistochemistry-Paraffin-NBP2-01346-img0004.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")