TROVE2 Antibody

Images

 
Immunohistochemistry-Paraffin: TROVE2 Antibody [NBP1-86998] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TROVE2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TROVE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Immunoprecipitation
Application Notes
Use in immunprecipitation reported in scientific literature (PMID 25885816). Western Blot data from customer review. For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TROVE2 Protein (NBP1-86998PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86998 in the following applications:

Publications
Read Publication using NBP1-86998.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TROVE2 Antibody

  • 60 kDa ribonucleoprotein Ro
  • 60 kDa Ro protein
  • 60 kDa SS-A/Ro ribonucleoprotein
  • Ro 60 kDa autoantigen
  • RO60gastric cancer multi-drug resistance protein
  • RORNP
  • Sjoegren syndrome antigen A2
  • Sjoegren syndrome type A antigen
  • Sjogren syndrome antigen A2 (60kDa, ribonucleoprotein autoantigen SS-A/Ro)
  • SS-A
  • SSA2Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro)
  • TROVE domain family member 2
  • TROVE domain family, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86998
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for TROVE2 Antibody (NBP1-86998)(1)

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
All Species

Review for TROVE2 Antibody (NBP1-86998) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-86998:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot TROVE2 NBP1-86998
Enlarge
reviewed by:
Charles Spurlock
WB Human 06/30/2014
View

Summary

ApplicationWestern Blot
Sample TestedHuman PBMC Whole Cell Lysate
SpeciesHuman

Blocking

Blocking DetailsOdyssey Blocking Buffer; 1 hour; room temperature

Primary Anitbody

Dilution Ratio1:200, overnight, 4 degrees celsius; Odyssey Blocking Buffer

Details

Detection NotesLi-COR Odyssey Infrared Imaging System

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TROVE2 Antibody (NBP1-86998) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TROVE2 Products

Bioinformatics Tool for TROVE2 Antibody (NBP1-86998)

Discover related pathways, diseases and genes to TROVE2 Antibody (NBP1-86998). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TROVE2 Antibody (NBP1-86998)

Discover more about diseases related to TROVE2 Antibody (NBP1-86998).
 

Pathways for TROVE2 Antibody (NBP1-86998)

View related products by pathway.

PTMs for TROVE2 Antibody (NBP1-86998)

Learn more about PTMs related to TROVE2 Antibody (NBP1-86998).

Blogs on TROVE2

There are no specific blogs for TROVE2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Charles Spurlock
06/30/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol TROVE2