Calreticulin Antibody

Western Blot: Calreticulin Antibody [NBP1-69107] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Calreticulin Antibody Summary

• Immunogen: Synthetic peptides corresponding to CALR (calreticulin) The peptide sequence was selected form the middle region of CALR. Peptide sequence PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT.
• Marker: Endoplasmic Reticulum Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This is a rabbit polyclonal antibody against CALR and was validated on Western blot.
• Control:

  Calreticulin Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Calreticulin Antibody

• Autoantigen Ro
• CALR
• Calregulin
• Calreticulin
• cC1qR
• CRP55
• CRT
• CRTC
• Endoplasmic reticulum resident protein 60
• ERp60
• FLJ26680
• grp60
• RO
• Sicca syndrome antigen A (autoantigen Ro; calreticulin)
• SSA
• SSAHACBP
• Vasostatin

Background

Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium. The amino terminus of calreticulin interacts with the DNA-binding domain of the glucocorticoid receptor and prevents the receptor from binding to its specific glucocorticoid response element. Calreticulin can inhibit the binding of androgen receptor to its hormone-responsive DNA element and can inhibit androgen receptor and retinoic acid receptor transcriptional activities in vivo, as well as retinoic acid-induced neuronal differentiation. Thus, calreticulin can act as an important modulator of the regulation of gene transcription by nuclear hormone receptors. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin but calreticulin is not a Ro/SS-A antigen. Earlier papers referred to calreticulin as an Ro/SS-A antigen but this was later disproven. Increased autoantibody titer against human calreticulin is found in infants with complete congenital heart block of both the IgG and IgM classes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CALR
• OMIM:
  • NP_004334(Human)