| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Calreticulin Antibody was developed against synthetic peptides corresponding to CALR (calreticulin). The peptide sequence was selected form the middle region of CALR. Peptide sequence PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT. The peptide sequence for this immunogen was taken from within the described region. |
| Marker | Endoplasmic Reticulum Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CALR |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Calreticulin Antibody (NBP1-69107)Find related products by research area.
|
|
Calreticulin - ER chaperone involved in calcium homeostasis and protein quality control Calreticulin is a calcium-dependent ER chaperone, involved in protein folding, maturation, and cellular localization. Calreticulin is a highly conserved 48 kDa protein encoded by the CALR gene. Calreticulin and its homolog calnexin regulate the fo... Read full blog post. |
|
Calnexin - an ER chaperone that folds the cell's glycoproteins Calnexin is an abundant 90kDa chaperone protein that resides in the membrane of the endoplasmic reticulum. Calnexin and the related calreticulin protein function together to ensure the proper folding of glycoproteins. By binding to partially folded... Read full blog post. |
|
Calreticulin: a Multiprocess Calcium Buffering Chaperone Calreticulin is a Calcium binding chaperone that has multiple functions both inside and outside the endoplasmic reticulum. Calreticulin is involved in the quality control of newly synthesized proteins and glycoproteins, interacting with various other ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.