Calcium-sensing R/CaSR Antibody - BSA Free

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Analysis in human parathyroid gland and skeletal muscle tissues using NBP2-38622 antibody. Corresponding CASR RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human kidney, liver, pancreas and parathyroid gland using Anti-CASR antibody NBP2-38622 (A) shows similar protein distribution across tissues to independent antibody NBP1-84687 (B).

Western Blot: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Analysis in control (vector only transfected HEK293T lysate) and CASR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human parathyroid gland shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human kidney shows moderate membranous positivity in cells in distal tubules.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human pancreas shows weak to moderate membranous positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP2-38622] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calcium-sensing R/CaSR Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calcium-sensing R/CaSR Antibody - BSA Free (NBP2-38622) is a polyclonal antibody validated for use in IHC and WB. Anti-Calcium-sensing R/CaSR Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLI
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CASR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID:32824949)
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Calcium-sensing R/CaSR Protein (NBP2-38622PEP)

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32824949).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calcium-sensing R/CaSR Antibody - BSA Free

• calcium-sensing receptor
• CAR
• CaSR
• EIG8
• extracellular calcium-sensing receptor
• FHH
• FIH
• GPRC2A
• GPRC2AHHC
• HHC1
• hypocalciuric hypercalcemia 1
• NSHPT
• parathyroid Ca(2+)-sensing receptor 1
• Parathyroid cell calcium-sensing receptor
• PCaR1
• PCAR1MGC138441

Background

Calcium-Sensing Receptor (CaSR) is a member of the G protein-coupled receptor family. CaSR is an integral membrane protein that senses changes in the extracellular concentration of calcium ions and controls the release of parathyroid hormone. The activity of the calcium-sensing receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Mutations that inactivate CaSR lead to familial hypocalciuric hypercalcemia, whereas mutations that activate CaSR cause autosomal dominant hypocalcemia. Calcium-Sensing Receptor antibodies are useful tools for parathyroid studies and research on cellular calcium homeostasis regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calcium-sensing R/CaSR Antibody (NBP2-38622)(1)

Publication using NBP2-38622

• Nunez-Salces M, Li H, Christie S, Page AJ The Effect of High-Fat Diet-Induced Obesity on the Expression of Nutrient Chemosensors in the Mouse Stomach and the Gastric Ghrelin Cell Nutrients 2020-08-19 [PMID: 32824949] (IHC-Fr, Mouse)

Bioinformatics

• Gene Symbol: CASR
• Uniprot:
  • P41180(Rat)