Calcium-sensing R/CaSR Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CASR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Calcium-sensing R/CaSR Antibody - BSA Free
Background
Calcium-Sensing Receptor (CaSR) is a member of the G protein-coupled receptor family. CaSR is an integral membrane protein that senses changes in the extracellular concentration of calcium ions and controls the release of parathyroid hormone. The activity of the calcium-sensing receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Mutations that inactivate CaSR lead to familial hypocalciuric hypercalcemia, whereas mutations that activate CaSR cause autosomal dominant hypocalcemia. Calcium-Sensing Receptor antibodies are useful tools for parathyroid studies and research on cellular calcium homeostasis regulation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IHC, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Publications for Calcium-sensing R/CaSR Antibody (NBP1-84687) (0)
There are no publications for Calcium-sensing R/CaSR Antibody (NBP1-84687).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Calcium-sensing R/CaSR Antibody (NBP1-84687) (0)
There are no reviews for Calcium-sensing R/CaSR Antibody (NBP1-84687).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Calcium-sensing R/CaSR Antibody (NBP1-84687) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Calcium-sensing R/CaSR Products
Research Areas for Calcium-sensing R/CaSR Antibody (NBP1-84687)
Find related products by research area.
|
Blogs on Calcium-sensing R/CaSR