Calcium-sensing R/CaSR Antibody - BSA Free

Western Blot: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Analysis in control (vector only transfected HEK293T lysate) and CASR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney shows strong cytoplasmic positivity in subset of cells in tubules.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human parathyroid gland shows high expression.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human liver.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human parathyroid gland using Anti-CASR antibody NBP1-84687.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human skeletal muscle using Anti-CASR antibody NBP1-84687.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney, liver, pancreas and parathyroid gland using Anti-CASR antibody NBP1-84687 (A) shows similar protein distribution across tissues to independent antibody NBP2-38622 (B).

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Analysis in human parathyroid gland and skeletal muscle tissues using NBP1-84687 antibody. Corresponding CASR RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human parathyroid gland shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney shows moderate membranous positivity in cells in distal tubules.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human pancreas shows moderate membranous positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calcium-sensing R/CaSR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CASR
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Calcium-sensing R/CaSR Protein (NBP1-84687PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calcium-sensing R/CaSR Antibody - BSA Free

• calcium-sensing receptor
• CAR
• CaSR
• EIG8
• extracellular calcium-sensing receptor
• FHH
• FIH
• GPRC2A
• GPRC2AHHC
• HHC1
• hypocalciuric hypercalcemia 1
• NSHPT
• parathyroid Ca(2+)-sensing receptor 1
• Parathyroid cell calcium-sensing receptor
• PCaR1
• PCAR1MGC138441

Background

Calcium-Sensing Receptor (CaSR) is a member of the G protein-coupled receptor family. CaSR is an integral membrane protein that senses changes in the extracellular concentration of calcium ions and controls the release of parathyroid hormone. The activity of the calcium-sensing receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.

Mutations that inactivate CaSR lead to familial hypocalciuric hypercalcemia, whereas mutations that activate CaSR cause autosomal dominant hypocalcemia. Calcium-Sensing Receptor antibodies are useful tools for parathyroid studies and research on cellular calcium homeostasis regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CASR