Calcium-sensing R/CaSR Antibody

Images

 
Western Blot: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Analysis in control (vector only transfected HEK293T lysate) and CASR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney shows strong cytoplasmic positivity in subset of cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calcium-sensing R/CaSR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CASR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Calcium-sensing R/CaSR Protein (NBP1-84687PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calcium-sensing R/CaSR Antibody

  • calcium-sensing receptor
  • CAR
  • CaSR
  • EIG8
  • extracellular calcium-sensing receptor
  • FHH
  • FIH
  • GPRC2A
  • GPRC2AHHC
  • HHC1
  • hypocalciuric hypercalcemia 1
  • NSHPT
  • parathyroid Ca(2+)-sensing receptor 1
  • Parathyroid cell calcium-sensing receptor
  • PCaR1
  • PCAR1MGC138441

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
AF7356
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-153
Species: Hu
Applications: WB, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-84687
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Calcium-sensing R/CaSR Antibody (NBP1-84687) (0)

There are no publications for Calcium-sensing R/CaSR Antibody (NBP1-84687).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcium-sensing R/CaSR Antibody (NBP1-84687) (0)

There are no reviews for Calcium-sensing R/CaSR Antibody (NBP1-84687). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calcium-sensing R/CaSR Antibody (NBP1-84687) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calcium-sensing R/CaSR Products

Bioinformatics Tool for Calcium-sensing R/CaSR Antibody (NBP1-84687)

Discover related pathways, diseases and genes to Calcium-sensing R/CaSR Antibody (NBP1-84687). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcium-sensing R/CaSR Antibody (NBP1-84687)

Discover more about diseases related to Calcium-sensing R/CaSR Antibody (NBP1-84687).
 

Pathways for Calcium-sensing R/CaSR Antibody (NBP1-84687)

View related products by pathway.

PTMs for Calcium-sensing R/CaSR Antibody (NBP1-84687)

Learn more about PTMs related to Calcium-sensing R/CaSR Antibody (NBP1-84687).
 

Research Areas for Calcium-sensing R/CaSR Antibody (NBP1-84687)

Find related products by research area.

Blogs on Calcium-sensing R/CaSR

There are no specific blogs for Calcium-sensing R/CaSR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calcium-sensing R/CaSR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CASR
Entrez