Calbindin D-28K Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining in human kidney and lymph node tissues using anti-CALB1 antibody. Corresponding CALB1 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human cerebellum, kidney, liver and lymph node using Anti-CALB1 antibody NBP2-38798 (A) shows similar ...read more
Western Blot: Calbindin D-28K Antibody [NBP2-38798] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human lymph node using Anti-CALB1 antibody NBP2-38798.
Immunohistochemistry: Calbindin D-28K Antibody [NBP2-38798] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human cerebellum.
Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human liver.
Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP2-38798] - Staining of human kidney using Anti-CALB1 antibody NBP2-38798.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Calbindin D-28K Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Calbindin D-28K Protein (NBP2-38798PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Calbindin D-28K Antibody - BSA Free

  • CAB27
  • CALB
  • calbindin 1, (28kD)
  • calbindin 1, 28kDa
  • Calbindin D28
  • calbindin
  • D-28K
  • RTVL-H protein
  • Vitamin D-dependent calcium-binding protein, avian-type

Background

Calbindin D28k is a member of a large family of intracellular calcium-binding proteins, containing EF-hand calcium binding motifs, and related to calmodulin and troponin-C. The biological roles of Calbindin D28k include calcium regulation and calcium-dependent signalling in neurons and during development. Decreases in Calbindin D28k abundance, or loss of Calbindin D28k immunoreactivity, is found in models of neurological disorders such as epilepsy, and in neurodegenerative diseases. Calbindin antibody is often used as a marker for cerebellum Purkinje cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11427
Species: Fe, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
AF3320
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-46349
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
AF2086
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, PEP-ELISA, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP2-38798
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for Calbindin D-28K Antibody (NBP2-38798) (0)

There are no publications for Calbindin D-28K Antibody (NBP2-38798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calbindin D-28K Antibody (NBP2-38798) (0)

There are no reviews for Calbindin D-28K Antibody (NBP2-38798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calbindin D-28K Antibody (NBP2-38798). (Showing 1 - 1 of 1 FAQ).

  1. I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
    • This link will take you to all of our alpha7 nicotinic cholingergic receptor antibodies currently available for purchase. Please see the following link for our Calbinin D28K antibodies reactive against mouse and human. We currently do not have any Parvalbumin antibodies that have been tested in mouse. I would like to introduce you to our Innovators Reward Program. Try our primary antibodies in an untested species or application, without the financial risk of failure. The pricing and availability of our products depends on your country.

Secondary Antibodies

 

Isotype Controls

Additional Calbindin D-28K Products

Research Areas for Calbindin D-28K Antibody (NBP2-38798)

Find related products by research area.

Blogs on Calbindin D-28K

There are no specific blogs for Calbindin D-28K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calbindin D-28K Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CALB1
Uniprot