Calbindin D-28K Antibody

Images

 
Western Blot: Calbindin D-28K Antibody [NBP1-86664] - Analysis in human kidney tissue.
Immunocytochemistry/ Immunofluorescence: Calbindin D-28K Antibody [NBP1-86664] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: Calbindin D-28K Antibody [NBP1-86664] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calbindin D-28K Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQ
Marker
Neuronal Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Calbindin D-28K Protein (NBP1-86664PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calbindin D-28K Antibody

  • CAB27
  • CALB
  • calbindin 1, (28kD)
  • calbindin 1, 28kDa
  • Calbindin D28
  • calbindin
  • D-28K
  • RTVL-H protein
  • Vitamin D-dependent calcium-binding protein, avian-type

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF3320
Species: Hu
Applications: WB, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-86664
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Calbindin D-28K Antibody (NBP1-86664) (0)

There are no publications for Calbindin D-28K Antibody (NBP1-86664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calbindin D-28K Antibody (NBP1-86664) (0)

There are no reviews for Calbindin D-28K Antibody (NBP1-86664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calbindin D-28K Antibody (NBP1-86664). (Showing 1 - 1 of 1 FAQ).

  1. I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
    • This link will take you to all of our <a href="http://www.novusbio.com/productsearch/alpha7%2Bnicotinic%2Bcholinergic%2Breceptor%2B#fq=common_name%3A%22CHRFAM7A%22&fq=species%3A%22Mouse%22" target="_self">alpha7 nicotinic cholingergic receptor antibodies</a> currently available for purchase. Please see the following link for our <a href="http://www.novusbio.com/CALB1-Calbindin-D-28K-Antibody-EP3478_NBP1-95327.html" target="_self">Calbinin D28K</a> antibodies reactive against mouse and human. We currently do not have any <a href="http://www.novusbio.com/productsearch/parvalbumin#fq=common_name%3A%22Parvalbumin%22" target="_self">Parvalbumin</a> antibodies that have been tested in mouse. I would like to introduce you to our <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>. Try our primary antibodies in an untested species or application, without the financial risk of failure. The pricing and availability of our products depends on your country.

Secondary Antibodies

 

Isotype Controls

Additional Calbindin D-28K Products

Bioinformatics Tool for Calbindin D-28K Antibody (NBP1-86664)

Discover related pathways, diseases and genes to Calbindin D-28K Antibody (NBP1-86664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calbindin D-28K Antibody (NBP1-86664)

Discover more about diseases related to Calbindin D-28K Antibody (NBP1-86664).
 

Pathways for Calbindin D-28K Antibody (NBP1-86664)

View related products by pathway.

Blogs on Calbindin D-28K

There are no specific blogs for Calbindin D-28K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calbindin D-28K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALB1