Cadherin-17 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88239] - Analysis in human duodenum and liver tissues using NBP1-88239 antibody. Corresponding Cadherin-17 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88239] - Staining of human colon, duodenum, kidney and liver using Anti-Cadherin-17 antibody NBP1-88239 (A) shows similar protein distribution across tissues to independent antibody NBP1-88238 (B).

Western Blot: Cadherin-17 Antibody [NBP1-88239] - Analysis in human cell line CACO-2.

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88239] - Staining of human kidney.

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88239] - Staining of human colon.

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88239] - Staining of human duodenum using Anti-CDH17 antibody NBP1-88239.

Immunohistochemistry-Paraffin: Cadherin-17 Antibody [NBP1-88239] - Staining of human liver using Anti-CDH17 antibody NBP1-88239.

Simple Western: Cadherin-17 Antibody [NBP1-88239] - Simple Western lane view shows a specific band for Cadherin-17 in 0.2 mg/ml of Colo205 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: Cadherin-17 Antibody [NBP1-88239] - Electropherogram image of the corresponding Simple Western lane view. Cadherin-17 antibody was used at 1:20 dilution on Colo205 lysate(s) respectively.

Analysis in human cell line CACO-2.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human duodenum shows strong membranous positivity in glandular cells.

Staining of human kidney shows no positivity in cells in tubules as expected.

Staining of human colon shows strong membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cadherin-17 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDH17
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in Colo205 lysates, separated by Size, antibody dilution of 1:20
• Control Peptide:

  Cadherin-17 Protein (NBP1-88239PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Cadherin-17 Antibody - BSA Free

• cadherin 17, LI cadherin (liver-intestine)
• cadherin
• cadherin-16
• Cadherin17
• Cadherin-17
• CDH16
• CDH17
• FLJ26931
• HPT-1 cadherin
• HPT1
• HPT-1
• human intestinal peptide-associated transporter HPT-1
• human peptide transporter 1
• Intestinal peptide-associated transporter HPT-1
• LI cadherin
• LI-cadherin
• Liver-intestine cadherin
• MGC138218
• MGC142024

Background

LI Cadherin is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDH17