MTF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MTF1 Antibody [NBP1-86380] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Analysis in human cell line HDLM-2.

Analysis in control (vector only transfected HEK293T lysate) and MTF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Bv
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MTF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MTF1 Antibody - BSA Free (NBP1-86380) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-MTF1 Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MTF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID 24529376 ).
  • Immunohistochemistry-Paraffin Reported in scientific literature (PMID: 24529376).
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MTF1 Recombinant Protein Antigen (NBP1-86380PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (85%). Mouse reactivity reported in scientific literature (PMID: 24529376). Bovine reactivity reported in scientific literature (PMID: 31068538).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MTF1 Antibody - BSA Free

• metal regulatory transcription factor 1
• metal-regulatory transcription factor 1
• metal-responsive transcription factor 1
• MGC23036
• MRE-binding transcription factor
• MRE-binding transcription factor-1
• MTF-1
• Transcription factor MTF-1
• zinc regulatory factor
• ZRF

Background

MTF1 encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MTF1 Antibody (NBP1-86380)(13)

Publications using NBP1-86380

• Hacisuleyman E, Hale CR, Noble N et Al. Neuronal activity rapidly reprograms dendritic translation via eIF4G2:uORF binding Nat Neurosci 2024-04-08 [PMID: 38589584]
• Zeynep Busra Aksoy-Ozer, Ceylan Verda Bitirim, Belma Turan, Kamil Can Akcali The Role of Zinc on Liver Fibrosis by Modulating ZIP14 Expression Throughout Epigenetic Regulatory Mechanisms. Biological trace element research 2024-01-15 [PMID: 38221603]
• Buchtova T, Beresova L, Chroma K et al. Cannabis-derived products antagonize platinum drugs by altered cellular transport Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie 2023-05-01 [PMID: 37137184] (Western Blot, Human)
• Han H, Nakaoka HJ, Hofmann L et al. The Hippo pathway kinases LATS1 and LATS2 attenuate cellular responses to heavy metals through phosphorylating MTF1 Nature cell biology 2022-01-01 [PMID: 35027733]
• Buchtova T, Skrott Z, Chroma K et al. Cannabidiol-induced activation of the metallothionein pathway impedes anticancer effects of disulfiram and its metabolite CuET Molecular Oncology 2022-04-01 [PMID: 34632694] (Western Blot, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Human, Mouse)
• Xuan J, Zhu D, Cheng Z et al. Crocin inhibits the activation of mouse hepatic stellate cells via the lnc-LFAR1/MTF-1/GDNF pathway Cell cycle (Georgetown, Tex.) 2020-12-09 [PMID: 33295246]
• Zhang R, Zhao G, Shi H et al. Zinc regulates primary ovarian tumor growth and metastasis through the epithelial to mesenchymal transition Free radical biology & medicine 2020-09-11 [PMID: 32927017] (WB, Human)
• Schwarz M, Lossow K, Kopp JF et al. Crosstalk of Nrf2 with the Trace Elements Selenium, Iron, Zinc, and Copper Nutrients 2019-09-05 [PMID: 31491970] (WB, Mouse)
• Han YE, Kwon J, Won J et al. Possible mechanisms underlying transcriptional induction of metallothionein isoforms by tris(pentafluorophenyl)stibane, tris(pentafluorophenyl)arsane, and tris(pentafluorophenyl)phosphane in cultured bovine aortic endothelial cells J Toxicol Sci 2019-05-10 [PMID: 31068538] (Chemotaxis, Bovine)
• Zhang, D;Zhang, T;Liu, J;Chen, J;Li, Y;Ning, G;Huo, N;Tian, W;Ma, H; Zn Supplement-Antagonized Cadmium-Induced Cytotoxicity in Macrophages In Vitro: Involvement of Cadmium Bioaccumulation and Metallothioneins Regulation J. Agric. Food Chem. 2019-04-24 [PMID: 30942077] (WB, ICC/IF, Mouse)
• LiangJi GZ, Zhang P, Huo W et al. Knockout of MTF1 Inhibits the Epithelial to Mesenchymal Transition in Ovarian Cancer Cells. Journal of Immunology Research. 2018-11-19 [PMID: 30588241] (WB, Human)
• Lee M, Won Y, Shin Y et al. Reciprocal activation of hypoxia-inducible factor (HIF)-2alpha and the zinc-ZIP8-MTF1 axis amplifies catabolic signaling in osteoarthritis. Osteoarthr. Cartil. 2015-08-01 [PMID: 26241779] (Chemotaxis, Mouse)
• Kim JH, Jeon J, Shin M et al. Regulation of the Catabolic Cascade in Osteoarthritis by the Zinc-ZIP8-MTF1 Axis. Cell 2014-02-17 [PMID: 24529376] (IHC-P, WB, IHC-Fr, Human, Mouse)

Bioinformatics

• Gene Symbol: MTF1