MTF1 Antibody

Images

 
Western Blot: MTF1 Antibody [NBP1-86380] - Analysis in control (vector only transfected HEK293T lysate) and MTF1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MTF1 Antibody [NBP1-86380] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Western Blot: MTF1 Antibody [NBP1-86380] - Analysis in human cell line HDLM-2.

Product Details

Summary
Reactivity Hu, Mu, BvSpecies Glossary
Applications WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLEDEDDDGQCG
Specificity
Specificity of human MTF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Chromatin Immunoprecipitation 1:10-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Frozen 1:10-1:500
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC-Frozen reported in scientific literature (PMID 24529376 ). Use in chromatin immunoprecipitation reported in scientific literature (PMID 26241779). Use in IHC-P reported in scientific literature (PMID: 24529376).
Control Peptide
Publications
Read Publications using
NBP1-86380 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (85%). Mouse reactivity reported in scientific literature (PMID: 24529376). Bovine reactivity reported in scientific literature (PMID: 31068538).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTF1 Antibody

  • metal regulatory transcription factor 1
  • metal-regulatory transcription factor 1
  • metal-responsive transcription factor 1
  • MGC23036
  • MRE-binding transcription factor
  • MRE-binding transcription factor-1
  • MTF-1
  • Transcription factor MTF-1
  • zinc regulatory factor
  • ZRF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
NBP1-62525
Species: Hu, Rt, Po, Ca, Eq, Rb
Applications: WB
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Ft, Mk, Pm, Rb, Sh, Xp
Applications: WB, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, TCS, KO, LA
H00002729-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-97493
Species: Hu, Mu, Rt, Eq, Fi, Rb
Applications: WB, EIA, IHC, IHC-P
NBP1-86380
Species: Hu, Mu, Bv
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for MTF1 Antibody (NBP1-86380)(6)

We have publications tested in 3 confirmed species: Human, Mouse, Bovine.

We have publications tested in 5 applications: ChIP, ICC/IF, IHC-Fr, IHC-P, WB.


Filter By Application
ChIP
(2)
ICC/IF
(1)
IHC-Fr
(1)
IHC-P
(1)
WB
(4)
All Applications
Filter By Species
Human
(2)
Mouse
(4)
Bovine
(1)
All Species
Showing Publications 1 - 6 of 6.
Publications using NBP1-86380 Applications Species
Schwarz M, Lossow K, Kopp JF et al. Crosstalk of Nrf2 with the Trace Elements Selenium, Iron, Zinc, and Copper Nutrients Sep 5 2019 [PMID: 31491970] (WB, Mouse) WB Mouse
Yang XL, Wang X, Shao L et al. Possible mechanisms underlying transcriptional induction of metallothionein isoforms by tris(pentafluorophenyl)stibane, tris(pentafluorophenyl)arsane, and tris(pentafluorophenyl)phosphane in cultured bovine aortic endothelial cells J Toxicol Sci May 10 2019 [PMID: 31068538] (ChIP, Bovine) ChIP Bovine
Zhang, D;Zhang, T;Liu, J;Chen, J;Li, Y;Ning, G;Huo, N;Tian, W;Ma, H; Zn Supplement-Antagonized Cadmium-Induced Cytotoxicity in Macrophages In Vitro: Involvement of Cadmium Bioaccumulation and Metallothioneins Regulation J. Agric. Food Chem. Apr 24 2019 [PMID: 30942077] (ICC/IF, WB, Mouse) ICC/IF, WB Mouse
LiangJi GZ, Zhang P, Huo W et al. Knockout of MTF1 Inhibits the Epithelial to Mesenchymal Transition in Ovarian Cancer Cells. Journal of Immunology Research. Nov 19 2018 [PMID: 30588241] (WB, Human) WB Human
Lee M, Won Y, Shin Y et al. Reciprocal activation of hypoxia-inducible factor (HIF)-2alpha and the zinc-ZIP8-MTF1 axis amplifies catabolic signaling in osteoarthritis. Osteoarthr. Cartil. 2015 Aug 01 [PMID: 26241779] (ChIP, Mouse) ChIP Mouse
Kim JH, Jeon J, Shin M et al. Regulation of the Catabolic Cascade in Osteoarthritis by the Zinc-ZIP8-MTF1 Axis. Cell 2014 Feb 17 [PMID: 24529376] (IHC-P, IHC-Fr, WB, Human, Mouse) IHC-P, IHC-Fr, WB Human, Mouse

Reviews for MTF1 Antibody (NBP1-86380) (0)

There are no reviews for MTF1 Antibody (NBP1-86380). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar
ICC/IF Video Protocol

FAQs for MTF1 Antibody (NBP1-86380) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MTF1 Products

Bioinformatics Tool for MTF1 Antibody (NBP1-86380)

Discover related pathways, diseases and genes to MTF1 Antibody (NBP1-86380). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTF1 Antibody (NBP1-86380)

Discover more about diseases related to MTF1 Antibody (NBP1-86380).
 

Pathways for MTF1 Antibody (NBP1-86380)

View related products by pathway.

PTMs for MTF1 Antibody (NBP1-86380)

Learn more about PTMs related to MTF1 Antibody (NBP1-86380).

Blogs on MTF1

There are no specific blogs for MTF1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTF1