Cadherin-16 Antibody - BSA Free

Western Blot: cadherin-16 Antibody [NBP1-59248] - Titration: 0.2-1 ug/ml Positive Control: Human brain.

Immunohistochemistry-Paraffin: cadherin-16 Antibody [NBP1-59248] - Human Kidney tissue, 5 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Cadherin-16 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CDH16(cadherin 16, KSP-cadherin) The peptide sequence was selected from the N terminal of CDH16. Peptide sequence SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDH16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 88 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27668431).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cadherin-16 Antibody - BSA Free

• cadherin 16, KSP-cadherin
• cadherin-16
• Kidney-specific cadherin
• KSP-cadherin

Background

CDH16 is a member of the cadherin superfamily, which are calcium-dependent, membrane-associated glycoproteins. CDH16 consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development.This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. Mapped to a previously identified cluster of cadherin genes on chromosome 16q22.1, the gene localizes with superfamily members CDH1, CDH3, CDH5, CDH8 and CDH11. The protein consists of an extracellular domain containing 6 cadherin domains, a transmembrane region and a truncated cytoplasmic domain but lacks the prosequence and tripeptide HAV adhesion recognition sequence typical of most classical cadherins. Expression is exclusively in kidney, where the protein functions as the principal mediator of homotypic cellular recognition, playing a role in the morphogenic direction of tissue development. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cadherin-16 Antibody (NBP1-59248)(4)

Publications using NBP1-59248

• Di Malta C, Zampelli A, Granieri L et al. TFEB and TFE3 drive kidney cystogenesis and tumorigenesis EMBO molecular medicine 2023-03-29 [PMID: 36987696] (IHC-P, Human)
• Won N, Castillo-Prado J, Tan X et al. Ex Vivo Perfusion Using a Mathematical Modeled, Controlled Gas Exchange Self-Contained Bioreactor Can Maintain a Mouse Kidney for Seven Days Cells 2022-06-02 [PMID: 35681517] (IF/IHC, Mouse)
• Sambi M, Chow T, Whiteley J et al. Acellular Mouse Kidney ECM can be Used as a Three-Dimensional Substrate to Test the Differentiation Potential of Embryonic Stem Cell Derived Renal Progenitors. Stem Cell Rev. 2017-02-27 [PMID: 28239758]
• Calcagni A, Kors L, Verschuren E et al. Modelling TFE renal cell carcinoma in mice reveals a critical role of WNT signaling Elife 2016-09-26 [PMID: 27668431] (IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: CDH16
• Uniprot:
  • O75309(Human)