![Western Blot: C9orf72 Antibody [NBP2-92755] - Western blot analysis of extracts of various cell lines, using C9orf72 antibody (NBP2-92755) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/C9orf72-Antibody-Western-Blot-NBP2-92755-img0007.jpg "Western Blot: C9orf72 Antibody [NBP2-92755] - Western blot analysis of extracts of various cell lines, using C9orf72 antibody (NBP2-92755) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit C9orf72 Antibody - Azide and BSA Free (NBP2-92755) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 9-200 of human C9orf72 (NP_001242983.1). SPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEID |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C9orf72 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for C9orf72 Antibody (NBP2-92755)Find related products by research area.
|
|
Amyotrophic Lateral Sclerosis Infographic Amyotrophic lateral sclerosis is a neurological disease which impacts motor neurons that are involved in muscle movement throughout the body. The progressive degeneration of neurons causes weakened muscles and can lead to paralysis. There is no cure f... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C9orf72 |
![Western Blot: C9orf72 Antibody [NBP2-92755] - Western blot analysis of extracts of Rat brain, using C9orf72 antibody (NBP2-92755) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/C9orf72 Antibody-Western Blot-NBP2-92755-img0008.jpg "Western Blot: C9orf72 Antibody [NBP2-92755] - Western blot analysis of extracts of Rat brain, using C9orf72 antibody (NBP2-92755) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
![Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP2-92755] - Immunohistochemistry of paraffin-embedded mouse kidney using C9orf72 Rabbit pAb (NBP2-92755) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/C9orf72-Antibody-Immunohistochemistry-Paraffin-NBP2-92755-img0006.jpg "Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP2-92755] - Immunohistochemistry of paraffin-embedded mouse kidney using C9orf72 Rabbit pAb (NBP2-92755) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP2-92755] - Immunohistochemistry of paraffin-embedded rat kidney using C9orf72 Rabbit pAb (NBP2-92755) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/C9orf72-Antibody-Immunohistochemistry-Paraffin-NBP2-92755-img0004.jpg "Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP2-92755] - Immunohistochemistry of paraffin-embedded rat kidney using C9orf72 Rabbit pAb (NBP2-92755) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP2-92755] - Immunohistochemistry of paraffin-embedded human esophageal cancer using C9orf72 Rabbit pAb (NBP2-92755) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/C9orf72-Antibody-Immunohistochemistry-Paraffin-NBP2-92755-img0005.jpg "Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP2-92755] - Immunohistochemistry of paraffin-embedded human esophageal cancer using C9orf72 Rabbit pAb (NBP2-92755) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: C9orf72 Antibody - Azide and BSA Free [NBP2-92755] - Immunofluorescence analysis of C6 cells using C9orf72 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92755_rabbit-polyclonal-c9orf72-antibody-4220251430445.jpg "Immunocytochemistry/ Immunofluorescence: C9orf72 Antibody - Azide and BSA Free [NBP2-92755] - Immunofluorescence analysis of C6 cells using C9orf72 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: C9orf72 Antibody - Azide and BSA Free [NBP2-92755] - Immunofluorescence analysis of NIH/3T3 cells using C9orf72 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92755_rabbit-polyclonal-c9orf72-antibody-4220251430437.jpg "Immunocytochemistry/ Immunofluorescence: C9orf72 Antibody - Azide and BSA Free [NBP2-92755] - Immunofluorescence analysis of NIH/3T3 cells using C9orf72 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: C9orf72 Antibody - Azide and BSA Free [NBP2-92755] - Immunofluorescence analysis of U2OS cells using C9orf72 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-92755_rabbit-polyclonal-c9orf72-antibody-42202514264428.jpg "Immunocytochemistry/ Immunofluorescence: C9orf72 Antibody - Azide and BSA Free [NBP2-92755] - Immunofluorescence analysis of U2OS cells using C9orf72 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Western_Blot_15520.jpg)
![Immunohistochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunohistochemistry_7155.jpg)
![Immunocytochemistry Progranulin/PGRN Antibody [Unconjugated]](https://images.novusbio.com/images2/Progranulin_AF2557_Immunocytochemistry__Immunofluorescence_23051.jpg)
![Western Blot ALS Antibody [Unconjugated]](https://images.novusbio.com/images2/ALS_AF1436_Western_Blot_17079.jpg)
![Western Blot CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/CHMP2B_MAB7509_Western_Blot_12719.jpg)
![Immunohistochemistry CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/CHMP2B_MAB7509_Immunohistochemistry_13107.jpg)
![Knockout Validated CHMP2B Antibody (791521) [Unconjugated]](https://images.novusbio.com/images2/mab7509_human-chmp2b-mab-clone-791521-knockout-validated-89202211244.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
![Bioactivity GM-CSF [Unconjugated]](https://images.novusbio.com/images/protein/7954-gmcf_recombinant-human-gm-csf-cho-expressed-protein-cf-bioactivity-272020121514.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")