C9orf72 Antibody

Images

 
Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C9orf72 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C9orf72
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID: 30003873).
Control Peptide
C9orf72 Protein (NBP1-93504PEP)
Publications
Read Publications using
NBP1-93504 in the following applications:

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 25521377).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C9orf72 Antibody

  • ALSFTD
  • C9orf72
  • chromosome 9 open reading frame 72
  • DENNL72
  • FTDALS
  • FTDALS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023435-M01
Species: Hu, Mu, Rt, Ba, Pp, I, Pm
Applications: WB, ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
AF1436
Species: Mu
Applications: WB
NB120-11433
Species: Hu, Mu, Rt, Pm, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB7509
Species: Hu
Applications: WB, IHC
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
NBP2-02627
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00029978-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
7954-GM/CF
Species: Hu

Publications for C9orf72 Antibody (NBP1-93504)(5)

Reviews for C9orf72 Antibody (NBP1-93504) (0)

There are no reviews for C9orf72 Antibody (NBP1-93504). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C9orf72 Antibody (NBP1-93504) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional C9orf72 Products

Bioinformatics Tool for C9orf72 Antibody (NBP1-93504)

Discover related pathways, diseases and genes to C9orf72 Antibody (NBP1-93504). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C9orf72 Antibody (NBP1-93504)

Discover more about diseases related to C9orf72 Antibody (NBP1-93504).
 

Pathways for C9orf72 Antibody (NBP1-93504)

View related products by pathway.

PTMs for C9orf72 Antibody (NBP1-93504)

Learn more about PTMs related to C9orf72 Antibody (NBP1-93504).

Blogs on C9orf72.

Amyotrophic Lateral Sclerosis Infographic
Amyotrophic lateral sclerosis is a neurological disease which impacts motor neurons that are involved in muscle movement throughout the body. The progressive degeneration of neurons causes weakened muscles and can lead to paralysis. There is no cure f...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C9orf72 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C9orf72
Entrez
Uniprot