Ubiquilin 2 Antibody (5F5)


Western Blot: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - Generation of transgenic mice that overexpress human ubiquilin-1. Immunoblots of equal amounts of total brain lysates from 12 month-old WT mouse, 12 month-old ...read more
Western Blot: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - Confirmation of polyQ-associated proteins from PC-12 cells identified by TAPI. Western blot analysis of TAPI-purified polyQ aggregates from PC-12 cells confirms ...read more
Immunocytochemistry/ Immunofluorescence: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - Analysis of monoclonal antibody to UBQLN2 on A-431 cell. Antibody concentration 10 ug/ml
Western Blot: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - Analysis of UBQLN2 expression in PC-12 (Cat # L012V1).
Western Blot: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - Analysis of UBQLN2 expression in Raw 264.7 (Cat # L024V1).
Western Blot: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - Analysis of UBQLN2 expression in A-431 (Cat # L015V1).
Western Blot: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - UBQLN2 shRNA knockdown in SH-SY5Y cells. First lane is the ladder, then treatment with scrambled shRNA and third lane is UBQLN2 knockdown. 30 ug of the protein ...read more
ELISA: Ubiquilin 2 Antibody (5F5) [H00029978-M03] - Detection limit for recombinant GST tagged UBQLN2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD

Order Details

Ubiquilin 2 Antibody (5F5) Summary

UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAIERLLGSQPS
UBQLN2 (5F5)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Knockdown Validated
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. Immunohistochemistry was reported in scientific literature. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 24475300)
Reviewed Applications
Read 1 Review rated 3
H00029978-M03 in the following applications:

Read Publications using
H00029978-M03 in the following applications:

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Ubiquilin 2 Antibody (5F5)

  • Chap1
  • CHAP1/DSK2
  • DSK2 homolog
  • DSK2
  • FLJ10167
  • FLJ56541
  • hPLIC-2
  • N4BP4LIC-2
  • Nedd4 binding protein 4
  • PLIC-2
  • PLIC2Dsk2
  • Protein linking IAP with cytoskeleton 2
  • RIHFB2157
  • ubiquilin 2
  • ubiquilin-2
  • Ubiquitin-like product Chap1/Dsk2


This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ba, Pp, I, Pm
Applications: WB, ELISA, Func, ICC/IF, IHC, IHC-P, IP, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD

Publications for Ubiquilin 2 Antibody (H00029978-M03)(26)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 5 applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 26. Show All 26 Publications.
Publications using H00029978-M03 Applications Species
Halloran M, Ragagnin AMG, Vidal M, et al. Amyotrophic lateral sclerosis-linked UBQLN2 mutants inhibit endoplasmic reticulum to Golgi transport, leading to Golgi fragmentation and ER stress Cell. Mol. Life Sci. Dec 4 2019 [PMID: 31802140] (WB) WB
Chen T, Huang B, Shi X et al. Mutant UBQLN2P497H in motor neurons leads to ALS-like phenotypes and defective autophagy in rats. Acta Neuropathol Commun Nov 8 2018 [PMID: 30409191]
Riku Y, Watanabe H, Yoshida M et al. Pathologic Involvement of Glutamatergic Striatal Inputs From the Cortices in TAR DNA-Binding Protein 43 kDa-Related Frontotemporal Lobar Degeneration and Amyotrophic Lateral Sclerosis. J Neuropathol Exp Neurol Sep 1 2017 [PMID: 28859339]
Wang CH, Huang YC, Chen PY et al. USP5/Leon deubiquitinase confines postsynaptic growth by maintaining ubiquitin homeostasis through Ubiquilin. Elife 2017 May 10 [PMID: 28489002]
Riku Y, Watanabe H, Yoshida M et al. Marked Involvement of the Striatal Efferent System in TAR DNA-Binding Protein 43 kDa-Related Frontotemporal Lobar Degeneration and Amyotrophic Lateral Sclerosis. J Neuropathol Exp Neurol 2016 Jun 26 [PMID: 27346748]
Arvaniti M, Jensen MM, Soni N et al. Functional interaction between Lypd6 and nicotinic acetylcholine receptors J. Neurochem. 2016 Jun 25 [PMID: 27344019] (WB, Rat) WB Rat
Ito M, Nakamura K, Mori F et al. Novel eosinophilic neuronal cytoplasmic inclusions in the external cuneate nucleus of humans. Neuropathology Mar 3 2016 [PMID: 26935872]
Wear MP, Kryndushkin D, O'Meally R et al. Proteins with Intrinsically Disordered Domains Are Preferentially Recruited to Polyglutamine Aggregates. PLoS ONE 2015 Aug 31 [PMID: 26317359] (WB, Rat) WB Rat
Shimada K, Fujii T, Tatsumi Y et al. Ubiquilin2 as a novel marker for detection of urothelial carcinoma cells in urine. Diagn Cytopathol 2016 Jan [PMID: 26303000]
Zeng L, Wang B, Merillat SA et al. Differential recruitment of UBQLN2 to nuclear inclusions in the polyglutamine diseases HD and SCA3 Neurobiol. Dis. 2015 Jun 30 [PMID: 26141599] (WB, IHC-P, Mouse, Human) WB, IHC-P Mouse, Human
Show All 26 Publications.

Review for Ubiquilin 2 Antibody (H00029978-M03) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00029978-M03:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Ubiquilin 2 H00029978-M03
reviewed by:
WB Human 02/24/2017


ApplicationWestern Blot
Sample TestedSH-SY5Y cell lysate


CommentsThe samples were lysed in Ripa buffer, followed by sonication. 30 ug of the protein sample was loaded on the gel and transferred to the nitrocellulose membrane. Blocked for 45 min at RT in 5 % milk in TBST, overnight incubation in primary antibodies at 4 °C in 5 % milk in TBST, washed with TBST 3x for 10 min, incubated in secondary antibodies (Goat Anti-mouse DyLight 550) at RT for 2 h and then imaged using BioRad ChemiDoc. Images were quantified using ImageLab Software (BioRad).
Knockdown of the upper band with shRNA for UBQLN2 was about 82 %, and of the lower band only about 8 %, suggesting a high specificity of the used shRNA, yet if comparing to the data provided in the antibody datasheet, my shRNA wouldn’t really be targeting UBQLN2, but some undefined band. It is possible that the antibody is not able to differentiate between UBQLN2 and the member of the same family, UBQLN1. UBQLN1 is slightly smaller than UBQLN2, but they both share a significant similarity at the C-terminus, from which the immunogen for the UBQLN2 antibody was raised.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ubiquilin 2 Antibody (H00029978-M03). (Showing 1 - 1 of 1 FAQs).

  1. Do you know if the mAb detects ubiquilin 1?
    • Based on the sequence homology, it looks like there could be some cross-reactivity with Ubiquilin 1. The immunogen sequence has 92% homology with bovine Ubiquilin 1.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Ubiquilin 2 Products

Bioinformatics Tool for Ubiquilin 2 Antibody (H00029978-M03)

Discover related pathways, diseases and genes to Ubiquilin 2 Antibody (H00029978-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ubiquilin 2 Antibody (H00029978-M03)

Discover more about diseases related to Ubiquilin 2 Antibody (H00029978-M03).

Pathways for Ubiquilin 2 Antibody (H00029978-M03)

View related products by pathway.

PTMs for Ubiquilin 2 Antibody (H00029978-M03)

Learn more about PTMs related to Ubiquilin 2 Antibody (H00029978-M03).

Blogs on Ubiquilin 2

There are no specific blogs for Ubiquilin 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol UBQLN2