C8G Antibody

Images

 
Western Blot: C8G Antibody [NBP2-14422] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: C8G Antibody [NBP2-14422] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C8G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTA MAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C8G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C8G Protein (NBP2-14422PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C8G Antibody

  • C8C
  • complement component 8, gamma polypeptide
  • complement component C8 gamma chain
  • MGC142186

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-09016
Species: Hu
MAB6529
Species: Hu
Applications: WB, Simple Western
MAB8126
Species: Hu
Applications: WB, Simple Western
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB100-64340
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr
NB100-63270
Species: Hu
Applications: WB, ELISA
NBP1-85990
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NBP2-24582
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP2-14422
Species: Hu
Applications: WB, IHC, IHC-P

Publications for C8G Antibody (NBP2-14422) (0)

There are no publications for C8G Antibody (NBP2-14422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C8G Antibody (NBP2-14422) (0)

There are no reviews for C8G Antibody (NBP2-14422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C8G Antibody (NBP2-14422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C8G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C8G