Complement C6 Antibody

Images

 
Western Blot: Complement C6 Antibody [NBP1-91803] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: Complement C6 Antibody [NBP1-91803] - Staining of human prostate shows strong granular cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Complement C6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA
Specificity
Specificity of human Complement C6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Complement C6 Antibody

  • complement component 6
  • complement component C6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-80406
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15952
Species: Hu, Mu
Applications: WB, ICC/IF
MAB6529
Species: Hu
Applications: WB, Simple Western
NB100-74621
Species: Hu
Applications: WB (-), IP
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, In vitro
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00113246-P01
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
NBP1-91803
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Complement C6 Antibody (NBP1-91803) (0)

There are no publications for Complement C6 Antibody (NBP1-91803).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Complement C6 Antibody (NBP1-91803) (0)

There are no reviews for Complement C6 Antibody (NBP1-91803). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Complement C6 Antibody (NBP1-91803) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Complement C6 Products

Bioinformatics Tool for Complement C6 Antibody (NBP1-91803)

Discover related pathways, diseases and genes to Complement C6 Antibody (NBP1-91803). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Complement C6 Antibody (NBP1-91803)

Discover more about diseases related to Complement C6 Antibody (NBP1-91803).
 

Pathways for Complement C6 Antibody (NBP1-91803)

View related products by pathway.

PTMs for Complement C6 Antibody (NBP1-91803)

Learn more about PTMs related to Complement C6 Antibody (NBP1-91803).
 

Research Areas for Complement C6 Antibody (NBP1-91803)

Find related products by research area.

Blogs on Complement C6

There are no specific blogs for Complement C6, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Complement C6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C6
COVID-19 update