![Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Analysis in human liver and cerebral cortex tissues. Corresponding C8B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/C8B-Antibody-Immunohistochemistry-Paraffin-NBP1-85990-img0006.jpg "Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Analysis in human liver and cerebral cortex tissues. Corresponding C8B RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit C8B Antibody - BSA Free (NBP1-85990) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C8B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for C8B Antibody (NBP1-85990)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C8B |
![Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Staining of human cerebral cortex shows no positivity in neurons.](http://images.novusbio.com/fullsize/C8B-Antibody-Immunohistochemistry-Paraffin-NBP1-85990-img0009.jpg "Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Staining of human cerebral cortex shows no positivity in neurons.")
![Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Staining shows distinct positivity in plasma.](http://images.novusbio.com/fullsize/C8B-Antibody-Immunohistochemistry-Paraffin-NBP1-85990-img0002.jpg "Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Staining shows distinct positivity in plasma.")
![Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Staining of human lung shows weak to moderate cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/C8B-Antibody-Immunohistochemistry-Paraffin-NBP1-85990-img0007.jpg "Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Staining of human lung shows weak to moderate cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/C8B-Antibody-Immunohistochemistry-Paraffin-NBP1-85990-img0008.jpg "Immunohistochemistry-Paraffin: C8B Antibody [NBP1-85990] - Staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.")
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)](http://images.novusbio.com/fullsize/nbp1-85990_rabbit-polyclonal-c8b-antibody-24420259321598.jpg "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)")
![Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Simple_Western_17147.jpg)
![Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Western_Blot_13068.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![SDS-PAGE Complement Component C5a [Unconjugated]](https://images.novusbio.com/images2/Complement_Component_C5a_2150-C5_638.jpg)
![Bioactivity Complement Component C5a [Unconjugated]](https://images.novusbio.com/images2/Complement_Component_C5a_2150-C5_647.jpg)
![Immunohistochemistry CCR2 Antibody (48607) [Unconjugated]](https://images.novusbio.com/images2/CCR2_MAB150_Immunohistochemistry_18879.jpg)
![Flow Cytometry CCR2 Antibody (48607) [Unconjugated]](https://images.novusbio.com/images2/CCR2_MAB150_Flow_Cytometry_19981.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Simple Western alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Simple_Western_20705.jpg)
![Western Blot alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Western_Blot_20706.jpg)
![Immunocytochemistry alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Immunocytochemistry__Immunofluorescence_17394.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")