PGD2 Synthase/PTGDS Antibody

Images

 
Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Staining of mouse brain . Image provided by Allison Brager - Department of Neurobiology, Morehouse School of Medicine.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

PGD2 Synthase/PTGDS Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the N terminal of human PTGDSThe immunogen for this antibody is PTGDS (NP_000945). Peptide sequence MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGDS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
  • Western Blot 1.0 ug/ml
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-79280 in the following applications:

Publications
Read Publications using NBP1-79280.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PGD2 Synthase/PTGDS Antibody

  • Beta-trace protein
  • Cerebrin-28
  • EC 5.3.99.2
  • Glutathione-independent PGD synthase
  • glutathione-independent PGD synthetase
  • lipocalin-type prostaglandin D synthase
  • Lipocalin-type prostaglandin-D synthase
  • L-PGDS
  • PDS
  • PGD2 Synthase
  • PGD2
  • PGDS2
  • PGDSLPGDS
  • PH2DISO
  • prostaglandin D synthase
  • prostaglandin D2 synthase (21kD, brain)
  • prostaglandin D2 synthase 21kDa (brain)
  • Prostaglandin-D2 synthase
  • prostaglandin-H2 D-isomerase
  • PTGDS

Background

Prostaglandin D Synthase (PTGDS), is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. PTGDS has also been implicated in the development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement (NREM) sleep. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. PTGDS is the most abundant protein in the cerebral spinal fluid and recent evidence suggests that PTGDS acts as a Beta-Amyloid chaperone and may have a role in the deposition of amyloid-b plaques in Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PGD2 Synthase/PTGDS Antibody (NBP1-79280)(3)

Review for PGD2 Synthase/PTGDS Antibody (NBP1-79280) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-79280:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin PGD2 Synthase/PTGDS NBP1-79280
Enlarge
5
reviewed by:
Verified Customer
IHC-P Mouse 08/08/2013
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedmouse brain
SpeciesMouse
LotQC18056

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGD2 Synthase/PTGDS Antibody (NBP1-79280). (Showing 1 - 1 of 1 FAQs).

  1. We have selected NBP1-79280 as the PTGDS antibody for ICH-P in our research. We noticed that IHC-P HIER pH6 retrieval is recommended for NBP1-81291, but there is no recommended retrieval method for NBP1-79280. So we want to ask that whether it is unnecessary to perform any retrieval method for NBP1-79280 in IHC-P protocol for the human brain tissues?
    • If an antigen retrieval method is not mentioned on the datasheet, it may be that it is not required. (The testing of this particular antibody is carried out for us by an external company, and so unfortunately I do not have all the details of the protocols used.) However, you may choose to carry out the antigen retrieval anyway, as it will only enhance the signal. We recommend the citrate buffer (pH 6) method described in our antigen retrieval protocol.

Secondary Antibodies

 

Isotype Controls

Additional PGD2 Synthase/PTGDS Products

Research Areas for PGD2 Synthase/PTGDS Antibody (NBP1-79280)

Find related products by research area.

Blogs on PGD2 Synthase/PTGDS

There are no specific blogs for PGD2 Synthase/PTGDS, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
08/08/2013
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol PTGDS
Entrez
Uniprot