PGD2 Synthase/PTGDS Antibody

Images

 
Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Titration: 1 ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Staining of mouse brain. Image provided by Allison Brager - Department of Neurobiology, Morehouse School of Medicine.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-79280] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGD2 Synthase/PTGDS Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human PTGDSThe immunogen for this antibody is PTGDS (NP_000945). Peptide sequence MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGDS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PTGDS and was validated on Western Blot and immunohistochemistry.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-79280 in the following applications:

Publications
Read Publications using NBP1-79280.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PGD2 Synthase/PTGDS Antibody

  • Beta-trace protein
  • Cerebrin-28
  • EC 5.3.99.2
  • Glutathione-independent PGD synthase
  • glutathione-independent PGD synthetase
  • lipocalin-type prostaglandin D synthase
  • Lipocalin-type prostaglandin-D synthase
  • L-PGDS
  • PDS
  • PGD2 Synthase
  • PGD2
  • PGDS2
  • PGDSLPGDS
  • PH2DISO
  • prostaglandin D synthase
  • prostaglandin D2 synthase (21kD, brain)
  • prostaglandin D2 synthase 21kDa (brain)
  • Prostaglandin-D2 synthase
  • prostaglandin-H2 D-isomerase
  • PTGDS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-14893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PGD2 Synthase/PTGDS Antibody (NBP1-79280)(2)

Review for PGD2 Synthase/PTGDS Antibody (NBP1-79280) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-79280:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin PGD2 Synthase/PTGDS NBP1-79280
Enlarge
reviewed by:
Anonymous
IHC-P Mouse 08/08/2013
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedmouse brain
SpeciesMouse
LotQC18056
CommentsThis antibody produced beautiful results much like the other antibodies I've purchased from Novus. I've rarely had issues with non-specific binding or serious background with Novus antibodies.

Blocking

Blocking Detailsgoat serum for 1 h (Vector Labs) at room temperature on shaker (150 uL serum/10 mL of TBS +0.1% BSA, TritonX, merthiolate

Primary Anitbody

Dilution Ratioovernight incubation in fridge at 1:1000 in TBS+0.1% BSA, TritonX, merthiolate

Secondary Antibody

Secondary Descriptiongoat anti-chicken
Secondary Manufacturer Cat#BA-9010
Secondary Concentration50 uL/10 mL of TBS

Details

Detection NotesDAB peroxidase
Fixation Detailsbrain extraction, storage in 4% PFA (pH=7.6) for 24 h followed by 30% sucrose for 24 h, brain sectioned on cryostat
Wash Description2-3 washes between blocking, primary, and secondary in TBS+0.1%BSA, tritonX, merthiolate or TBS alone (secondary)

Comments

CommentsThis antibody produced beautiful results much like the other antibodies I've purchased from Novus. I've rarely had issues with non-specific binding or serious background with Novus antibodies.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGD2 Synthase/PTGDS Antibody (NBP1-79280). (Showing 1 - 1 of 1 FAQs).

  1. We have selected NBP1-79280 as the PTGDS antibody for ICH-P in our research. We noticed that IHC-P HIER pH6 retrieval is recommended for NBP1-81291, but there is no recommended retrieval method for NBP1-79280. So we want to ask that whether it is unnecessary to perform any retrieval method for NBP1-79280 in IHC-P protocol for the human brain tissues?
    • If an antigen retrieval method is not mentioned on the datasheet, it may be that it is not required. (The testing of this particular antibody is carried out for us by an external company, and so unfortunately I do not have all the details of the protocols used.) However, you may choose to carry out the antigen retrieval anyway, as it will only enhance the signal. We recommend the citrate buffer (pH 6) method described in our antigen retrieval protocol.

Secondary Antibodies

 

Isotype Controls

Additional PGD2 Synthase/PTGDS Products

Bioinformatics Tool for PGD2 Synthase/PTGDS Antibody (NBP1-79280)

Discover related pathways, diseases and genes to PGD2 Synthase/PTGDS Antibody (NBP1-79280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGD2 Synthase/PTGDS Antibody (NBP1-79280)

Discover more about diseases related to PGD2 Synthase/PTGDS Antibody (NBP1-79280).
 

Pathways for PGD2 Synthase/PTGDS Antibody (NBP1-79280)

View related products by pathway.

Blogs on PGD2 Synthase/PTGDS

There are no specific blogs for PGD2 Synthase/PTGDS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
08/08/2013
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol PTGDS
Entrez
Uniprot