C12orf29 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C12orf29 Antibody [NBP1-84177] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: C12orf29 Antibody [NBP1-84177] - Staining of human small intestine shows strong cytoplasmic positivity, seen with a granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C12orf29 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QIRNLPSLKHNDLLSWFEDCKEGKIEGIVWHCSDGCLIKVHRHHLGLCWPIPDTYMNSRPVIINMNLNKCDSA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C12ORF29
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C12orf29 Protein (NBP1-84177PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C12orf29 Antibody

  • chromosome 12 open reading frame 29
  • DKFZp313K0436
  • DKFZp434N2030
  • DKFZp686L04169
  • FLJ38158
  • hypothetical protein LOC91298
  • MGC102978

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-45511
Species: Hu
Applications: WB, IHC
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-93983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87447
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBL1-08307
Species: Hu
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB100-87003
Species: Hu, Rt
Applications: WB, IP, PLA
H00064746-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-6586
Species: Hu, Mu, Rt, Bv, Ma
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
MAB2374
Species: Hu, Mu
Applications: WB

Publications for C12orf29 Antibody (NBP1-84177) (0)

There are no publications for C12orf29 Antibody (NBP1-84177).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C12orf29 Antibody (NBP1-84177) (0)

There are no reviews for C12orf29 Antibody (NBP1-84177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C12orf29 Antibody (NBP1-84177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C12orf29 Products

Bioinformatics Tool for C12orf29 Antibody (NBP1-84177)

Discover related pathways, diseases and genes to C12orf29 Antibody (NBP1-84177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C12orf29 Antibody (NBP1-84177)

Discover more about diseases related to C12orf29 Antibody (NBP1-84177).
 

Pathways for C12orf29 Antibody (NBP1-84177)

View related products by pathway.

Blogs on C12orf29

There are no specific blogs for C12orf29, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C12orf29 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C12ORF29