FXYD5/Dysadherin Antibody

Images

 
Western Blot: FXYD5/Dysadherin Antibody [NBP1-82486] - Analysis in control (vector only transfected HEK293T lysate) and FXYD5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: FXYD5/Dysadherin Antibody [NBP1-82486] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FXYD5/Dysadherin Antibody [NBP1-82486] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Western Blot: FXYD5/Dysadherin Antibody [NBP1-82486] - Analysis in human cell lines SK-MEL-30 and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FXYD5/Dysadherin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FXYD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FXYD5/Dysadherin Protein (NBP1-82486PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FXYD5/Dysadherin Antibody

  • DYSAD
  • Dysadherin
  • EF-8
  • FXYD domain containing ion transport regulator 5
  • FXYD domain-containing ion transport regulator 5
  • FXYD5
  • IWU1
  • KCT1
  • keratinocytes associated transmembrane protein 1
  • OIT2
  • PRO6241
  • RIC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NB100-56414
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP2-75656
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-95165
Species: Mu, Rt
Applications: WB
NBP2-31993
Species: Hu
Applications: IHC, IHC-P, WB
MAB4697
Species: Hu
Applications: WB
NBP2-48725
Species: Hu
Applications: IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-29460
Species: Pm, Pm-Cm, Hu, Pm, RM
Applications: Flow, ICC/IF, IHC, IHC-P, ISH
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
AF5129
Species: Hu
Applications: WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-82486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FXYD5/Dysadherin Antibody (NBP1-82486) (0)

There are no publications for FXYD5/Dysadherin Antibody (NBP1-82486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXYD5/Dysadherin Antibody (NBP1-82486) (0)

There are no reviews for FXYD5/Dysadherin Antibody (NBP1-82486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FXYD5/Dysadherin Antibody (NBP1-82486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FXYD5/Dysadherin Products

Bioinformatics Tool for FXYD5/Dysadherin Antibody (NBP1-82486)

Discover related pathways, diseases and genes to FXYD5/Dysadherin Antibody (NBP1-82486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXYD5/Dysadherin Antibody (NBP1-82486)

Discover more about diseases related to FXYD5/Dysadherin Antibody (NBP1-82486).
 

Pathways for FXYD5/Dysadherin Antibody (NBP1-82486)

View related products by pathway.

PTMs for FXYD5/Dysadherin Antibody (NBP1-82486)

Learn more about PTMs related to FXYD5/Dysadherin Antibody (NBP1-82486).
 

Research Areas for FXYD5/Dysadherin Antibody (NBP1-82486)

Find related products by research area.

Blogs on FXYD5/Dysadherin

There are no specific blogs for FXYD5/Dysadherin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FXYD5/Dysadherin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FXYD5
Entrez
Uniprot