CLIC4 Antibody - BSA Free

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-CLIC4 antibody. Corresponding CLIC4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.

Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA008019 antibody. Corresponding CLIC4 RNA-seq data are presented for the same tissues.

Staining of human kidney, liver, pancreas and skeletal muscle using Anti-CLIC4 antibody NBP1-85574 (A) shows similar protein distribution across tissues to independent antibody NBP2-49321 (B).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CLIC4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CLIC4 Antibody - BSA Free (NBP1-85574) is a polyclonal antibody validated for use in IHC and WB. Anti-CLIC4 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGI
• Predicted Species: Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CLIC4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CLIC4 Protein (NBP1-85574PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CLIC4 Antibody - BSA Free

• chloride intracellular channel 4 like
• chloride intracellular channel 4
• chloride intracellular channel protein 4
• CLIC4L
• DKFZp566G223
• FLJ38640
• H1
• huH1
• Intracellular chloride ion channel protein p64H1
• MTCLIC
• P64H1

Background

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CLIC4 Antibody (NBP1-85574)(4)

Publications using NBP1-85574

• Mao Y, Kleinjan ML, Jilishitz I et al. CLIC1 and CLIC4 mediate endothelial S1P receptor signaling to facilitate Rac1 and RhoA activity and function Science signaling 2021-04-20 [PMID: 33879602]
• Yan H, Zhang X, Hu W et al. Histamine H3 receptors aggravate cerebral ischaemic injury by histamine-independent mechanisms. Nat Commun 2014-02-25 [PMID: 24566390]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Lomnytska MI, Becker S, Gemoll T et al. Impact of genomic stability on protein expression in endometrioid endometrial cancer. Br J Cancer 2012-03-27 [PMID: 22415234]

Bioinformatics

• Gene Symbol: CLIC4