BRD4 Antibody (CL1115)

Images

 
Genetic Strategies: Western Blot: BRD4 Antibody (CL1115) [NBP2-52958] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-BRD4 antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: BRD4 Antibody (CL1115) [NBP2-52958] - Staining of MCF-7 cells using the Anti-BRD4 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and ...read more
Immunohistochemistry-Paraffin: BRD4 Antibody (CL1115) [NBP2-52958] - Staining of human kidney shows moderate nuclear positivity in cells in renal glomeruli and in tubules.
Western Blot: BRD4 Antibody (CL1115) [NBP2-52958] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG
Immunohistochemistry-Paraffin: BRD4 Antibody (CL1115) [NBP2-52958] - Staining of human stomach cancer shows moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: BRD4 Antibody (CL1115) [NBP2-52958] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BRD4 Antibody (CL1115) [NBP2-52958] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clone
CL1115
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

BRD4 Antibody (CL1115) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP
Epitope
PQPAKPQQVIQHHHS
Specificity
Specificity of human BRD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
BRD4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control
BRD4 Knockout 293T Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for BRD4 Antibody (CL1115)

  • bromodomain containing 4
  • bromodomain-containing 4
  • CAPchromosome-associated protein
  • HUNK1bromodomain-containing protein 4
  • HUNKI
  • MCAP
  • Protein HUNK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
AF5535
Species: Hu
Applications: WB, Simple Western
AF6386
Species: Hu
Applications: WB, IP
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
7270-IL/CF
Species: Hu
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP2-45946
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP2-52958
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for BRD4 Antibody (NBP2-52958) (0)

There are no publications for BRD4 Antibody (NBP2-52958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRD4 Antibody (NBP2-52958) (0)

There are no reviews for BRD4 Antibody (NBP2-52958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BRD4 Antibody (NBP2-52958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional BRD4 Products

Bioinformatics Tool for BRD4 Antibody (NBP2-52958)

Discover related pathways, diseases and genes to BRD4 Antibody (NBP2-52958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRD4 Antibody (NBP2-52958)

Discover more about diseases related to BRD4 Antibody (NBP2-52958).
 

Pathways for BRD4 Antibody (NBP2-52958)

View related products by pathway.

PTMs for BRD4 Antibody (NBP2-52958)

Learn more about PTMs related to BRD4 Antibody (NBP2-52958).

Blogs on BRD4.

Epigenetic Control of Autophagy
By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studied....  Read full blog post.

Understanding the relationship between NUT and BET proteins in NMC
NUT has been found to fuse with bromodomain-containing proteins 3 and 4 (BRD3 and BRD4) in NUT midline carcinoma (NMC), a very rare, extremely aggressive, and genetically defined human cancer. NMC has recently been designated as a sub classificati...  Read full blog post.

NUT - A Protein Coding Gene
The NUT gene is found on chromosome 15q14 and encodes for the NUT protein which is a key component of the RNA polymerase II Mediator complex. This multi-subunit assembly is required for all RNA pol II-dependent transcriptional activation, coordinating...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRD4 Antibody (CL1115) and receive a gift card or discount.

Bioinformatics

Gene Symbol BRD4