| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VHPISLSSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENEDNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQIKEDLS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BRCA2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BRCA2 Antibody (NBP1-88361)Find related products by research area.
|
|
FANCD2 and DNA damage repair Fanconi anemia (FA) is a genetically inherited disorder that yields cytogenetic instability, hypersensitivity to DNA crosslinking compounds and defective DNA repair. A variety of genes have been identified within the FA pathway that are referred t... Read full blog post. |
|
Breast Cancer Infographic Breast cancer is caused by malignant cells developing in breast tissue. It is the most commonly diagnosed cancer in women, but advancements in treatment options have seen the death rate decline since the 1990s. Common warning signs of breast cancer in... Read full blog post. |
|
RAD51: The cell's 'Mr. Fix-it' RAD51 is a recombinase protein encoded by RAD51 gene in humans. Human RAD51 family members are highly similar to bacterial RecA and yeast Rad51, both biochemically and structurally. It is a 339-amino acid protein that plays an important role in homolo... Read full blog post. |
|
Breast Cancer and RAD51L1 Antibodies In the United States, breast cancer is one of the most common cancers and the second leading cause of cancer related deaths in women. According to the American Cancer Society's most recent estimates for breast cancer in the United States, there are ab... Read full blog post. |
|
Determining DMC1's role in Homologus Recombination The DMC1 gene encodes a 36.7 kDa nuclear protein involved in meiotic homologous recombination. This recombinase is functionally related to the yeast RAD51 and E. coli RecA genes. In contrast to RAD51, which functions in both mitotic and meiotic recomb... Read full blog post. |
|
Rad51 Antibody Reveals a Canine Model for Human Breast Cancer Our antibody catalog includes an extensive range of Rad51 antibody reagents. Encoded by the RAD51 gene, the Rad51 protein plays a vital role in DNA repair, interacting with several other proteins, including BRCA1 and BRCA2, to effect homologous recomb... Read full blog post. |
|
Industrial Chemicals, Tumour Suppressor Genes and the Need for More Research Human cancer research is the largest research area in our antibody database, with new oncogenes and cell lines being added all the time.Cancer triggers come from many sources, with a worrying amount of evidence to suggest that chemicals we’re in con... Read full blog post. |
|
Fanconi Antibodies and Cancer Research We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.