![Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining in human salivary gland and liver tissues using anti-BPIFB2 antibody. Corresponding BPIFB2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BPIL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38887-img0004.jpg "Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining in human salivary gland and liver tissues using anti-BPIFB2 antibody. Corresponding BPIFB2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit BPIL1 Antibody - BSA Free (NBP2-38887) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGALNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BPIFB2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Western_Blot_5541.jpg)
![Immunohistochemistry ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Immunohistochemistry_11702.jpg)
![Immunocytochemistry ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Immunocytochemistry__Immunofluorescence_20270.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for BPIL1 Antibody (NBP2-38887)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human colon, kidney, liver and salivary gland using Anti-BPIFB2 antibody NBP2-38887 (A) shows similar protein distribution across tissues to independent antibody NBP2-14358 (B).](http://images.novusbio.com/fullsize/BPIL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38887-img0005.jpg "Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human colon, kidney, liver and salivary gland using Anti-BPIFB2 antibody NBP2-38887 (A) shows similar protein distribution across tissues to independent antibody NBP2-14358 (B).")
![Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human colon.](http://images.novusbio.com/fullsize/BPIL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38887-img0007.jpg "Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human colon.")
![Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/BPIL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38887-img0002.jpg "Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human salivary gland shows high expression.](http://images.novusbio.com/fullsize/BPIL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38887-img0003.jpg "Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human salivary gland shows high expression.")
![Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human kidney.](http://images.novusbio.com/fullsize/BPIL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38887-img0006.jpg "Immunohistochemistry-Paraffin: BPIL1 Antibody [NBP2-38887] - Staining of human kidney.")
![BPI [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "BPI [Unconjugated]")
![N/A LBP [Biotin]](https://images.novusbio.com/images2/DATA_LBP_DY87005_ELISA_2551.jpg)
![N/A Trappin-2/Elafin/Skalp [Biotin]](https://images.novusbio.com/images2/DATA_Trappin2_DY1747_ELISA_1708.jpg)
![SDS-PAGE Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_695.jpg)
![Bioactivity Lymphotoxin-alpha/TNF-beta [Unconjugated]](https://images.novusbio.com/images2/Lymphotoxin-alpha_211-TBB_CF_697.jpg)
![Western Blot SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Western_Blot_20730.jpg)
![Immunohistochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunohistochemistry_10419.jpg)
![Immunocytochemistry SPARC Antibody [Unconjugated]](https://images.novusbio.com/images2/SPARC_AF942_Immunocytochemistry__Immunofluorescence_23321.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")