Bone marrow stromal cell antigen 1/CD157 Antibody - BSA Free

Immunohistochemistry-Paraffin: Bone marrow stromal cell antigen 1 Antibody [NBP2-14363] Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Bone marrow stromal cell antigen 1/CD157 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Bone marrow stromal cell antigen 1/CD157 Antibody - BSA Free (NBP2-14363) is a polyclonal antibody validated for use in IHC. Anti-Bone marrow stromal cell antigen 1/CD157 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BST1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Bone marrow stromal cell antigen 1/CD157 Antibody - BSA Free

• ADP-ribosyl cyclase 2
• Bone marrow stromal antigen 1
• bone marrow stromal cell antigen 1
• BP-3
• BST1
• BST-1
• cADPr hydrolase 2
• CD157 antigen
• CD157
• Cyclic ADP-ribose hydrolase 2
• EC 3.2.2.5
• NAD(+) nucleosidase

Background

Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone marrow stromal cell lines derived from patients with rheumatoid arthritis. The polyclonal B-cell abnormalities in rheumatoid arthritis may be, at least in part, attributed to BST1 overexpression in the stromal cell population. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363)(1)

Publication using NBP2-14363

• Codreanu SG, Hoeksema MD, Slebos RJC et al. Identification of Proteomic Features to Distinguish Benign Pulmonary Nodules from Lung Adenocarcinoma J. Proteome Res. 2017-07-21 [PMID: 28731711] (Human)

Bioinformatics

• Gene Symbol: BST1