Bone marrow stromal cell antigen 1/CD157 Antibody


Immunohistochemistry-Paraffin: Bone marrow stromal cell antigen 1 Antibody [NBP2-14363] Staining of human smooth muscle shows moderate cytoplasmic positivity in smooth muscle cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Bone marrow stromal cell antigen 1/CD157 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVL PSDYDLFINLSRHSIPRDKSLFWE
Specificity of human Bone marrow stromal cell antigen 1/CD157 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Bone marrow stromal cell antigen 1/CD157 Protein (NBP2-14363PEP)
Read Publication using NBP2-14363.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Bone marrow stromal cell antigen 1/CD157 Antibody

  • ADP-ribosyl cyclase 2
  • Bone marrow stromal antigen 1
  • bone marrow stromal cell antigen 1
  • BP-3
  • BST1
  • BST-1
  • cADPr hydrolase 2
  • CD157 antigen
  • CD157
  • Cyclic ADP-ribose hydrolase 2
  • EC
  • NAD(+) nucleosidase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
Species: Hu
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Species: Hu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: IHC, IHC-P

Publications for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363)(1)

We have publications tested in 1 confirmed species: Human.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363) (0)

There are no reviews for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363)

Discover related pathways, diseases and genes to Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363)

Discover more about diseases related to Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363).

Pathways for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363)

View related products by pathway.

PTMs for Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363)

Learn more about PTMs related to Bone marrow stromal cell antigen 1/CD157 Antibody (NBP2-14363).

Blogs on Bone marrow stromal cell antigen 1/CD157

There are no specific blogs for Bone marrow stromal cell antigen 1/CD157, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Bone marrow stromal cell antigen 1/CD157 Antibody and receive a gift card or discount.


Gene Symbol BST1