GAK Antibody

Images

 
Immunocytochemistry: GAK Antibody [NBP1-89441] - Staining of human cell line A-431 shows positivity in cytoplasm and golgi apparatus.
Immunohistochemistry-Paraffin: GAK Antibody [NBP1-89441] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: GAK Antibody [NBP1-89441] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, ICC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunocytochemistry
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GAK Protein (NBP1-89441PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAK Antibody

  • Auxillin 2
  • cyclin G associated kinase
  • cyclin-G-associated kinase
  • EC 2.7.11.1
  • FLJ16629
  • FLJ40395
  • GAK
  • MGC99654

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000900-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81507
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
AF4736
Species: Hu
Applications: WB
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6886
Species: Hu
Applications: WB
NBP2-38121
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1029
Species: Mu
Applications: WB, IHC, IP
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6598
Species: Hu, Mu, Rt
Applications: WB
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87001
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, ICC

Publications for GAK Antibody (NBP1-89441) (0)

There are no publications for GAK Antibody (NBP1-89441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAK Antibody (NBP1-89441) (0)

There are no reviews for GAK Antibody (NBP1-89441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GAK Antibody (NBP1-89441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAK Products

Bioinformatics Tool for GAK Antibody (NBP1-89441)

Discover related pathways, diseases and genes to GAK Antibody (NBP1-89441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAK Antibody (NBP1-89441)

Discover more about diseases related to GAK Antibody (NBP1-89441).
 

Pathways for GAK Antibody (NBP1-89441)

View related products by pathway.

PTMs for GAK Antibody (NBP1-89441)

Learn more about PTMs related to GAK Antibody (NBP1-89441).
 

Research Areas for GAK Antibody (NBP1-89441)

Find related products by research area.

Blogs on GAK

There are no specific blogs for GAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAK
Entrez