GAK Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: GAK Antibody [NBP1-89441] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GAK Antibody [NBP1-89441] - Staining of human Skeletal muscle shows no granular cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: GAK Antibody [NBP1-89441] - Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: GAK Antibody [NBP1-89441] - Staining of human Stomach shows strong granular cytoplasmic positivity in glandular cells.

Staining of human Prostate shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GAK Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GAK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GAK Protein (NBP1-89441PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GAK Antibody - BSA Free

• Auxillin 2
• cyclin G associated kinase
• cyclin-G-associated kinase
• EC 2.7.11.1
• FLJ16629
• FLJ40395
• GAK
• MGC99654

Background

In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GAK