Novus Biologicals products are now on bio-techne.com

GAK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GAK Antibody [NBP1-89441] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GAK Antibody [NBP1-89441] - Staining of human Skeletal muscle shows no granular cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: GAK Antibody [NBP1-89441] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GAK Antibody [NBP1-89441] - Staining of human Kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GAK Antibody [NBP1-89441] - Staining of human Stomach shows strong granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVE
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GAK Protein (NBP1-89441PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAK Antibody

  • Auxillin 2
  • cyclin G associated kinase
  • cyclin-G-associated kinase
  • EC 2.7.11.1
  • FLJ16629
  • FLJ40395
  • GAK
  • MGC99654

Background

In all eukaryotes, the cell cycle is governed by cyclin-dependent protein kinases (CDKs), whose activities are regulated by cyclins and CDK inhibitors in a diverse array of mechanisms that involve the control of phosphorylation and dephosphorylation of Ser, Thr or Tyr residues. Cyclins are molecules that possess a consensus domain called the 'cyclin box.' In mammalian cells, 9 cyclin species have been identified, and they are referred to as cyclins A through I. Cyclin G is a direct transcriptional target of the p53 tumor suppressor gene product and thus functions downstream of p53. GAK is an association partner of cyclin G and CDK5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92649
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
NBP1-81507
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF4736
Species: Hu
Applications: WB
NB300-268
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-84110
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00080055-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB6598
Species: Hu, Mu, Rt
Applications: WB
NB300-206
Species: Ba, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP3-12546
Species: Hu
Applications: IHC-P, IP, WB
NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-89441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for GAK Antibody (NBP1-89441) (0)

There are no publications for GAK Antibody (NBP1-89441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAK Antibody (NBP1-89441) (0)

There are no reviews for GAK Antibody (NBP1-89441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GAK Antibody (NBP1-89441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAK Products

Research Areas for GAK Antibody (NBP1-89441)

Find related products by research area.

Blogs on GAK

There are no specific blogs for GAK, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAK