BNIP3L Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP2-92792] - Immunohistochemistry of paraffin-embedded rat kidney using BNIP3L Rabbit pAb (NBP2-92792) at dilution of 1:100 (40x lens). Perform high pressure antigen ...read more
Immunohistochemistry-Paraffin: BNIP3L Antibody [NBP2-92792] - Immunohistochemistry of paraffin-embedded mouse lung using BNIP3L Rabbit pAb (NBP2-92792) at dilution of 1:100 (40x lens). Perform high pressure antigen ...read more
Immunocytochemistry/ Immunofluorescence: BNIP3L Antibody - Azide and BSA Free [NBP2-92792] - Immunofluorescence analysis of NIH/3T3 cells using BNIP3L Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: ...read more
Western Blot: BNIP3L Antibody - Azide and BSA Free [NBP2-92792] - Western blot analysis of lysates from PC-12 cells using BNIP3L Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

BNIP3L Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit BNIP3L Antibody - BSA Free (NBP2-92792) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 95-180 of human BNIP3L (NP_004322.1). SPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMKKGGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BNIP3L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for BNIP3L Antibody - BSA Free

  • Adenovirus E1B19K-binding protein B5
  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A
  • BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
  • BCL2/adenovirus E1B 19-kd protein-interacting protein 3a
  • BCL2/adenovirus E1B 19kDa interacting protein 3-like
  • BNIP3a
  • BNIP3H
  • BNIP3L
  • Nip3L
  • NIP3-like protein X
  • Nix
  • NIXBCL2/adenovirus E1B 19kD-interacting protein 3-like

Background

Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, Hrk, Nip3, and Bim, form a growingsubclass of the Bcl-2 family. A novel BH3 domaincontaining protein was recently identified and designated Bnip3L, Bnip3a, and Nix (for Nip3-like protein X) (Matsushima, M. et al.; Yasuda, M. et al.; Chen, G, et al.).Bnip3L/Bnip3a/Nix is a homolog of the E1B 19K/Bcl-2 binding and pro-apoptotic protein Bnip3. Over expression of Bnip3L induces apoptosis (Yasuda, M. et al.; Chen, G, et al.). Bnip3L interacts withand overcomes suppresses by Bcl-2 and Bcl-xL. Bnip3Lis localized in mitochondria. The messenger RNA of Bnip3L is ubiquitously expressed in human tissues (Matsushima, M. et al.; Yasuda, M. et al.). Bnip3L and Bnip3 form a new subfamily of the pro-apoptotic mitochondrial proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56150
Species: Ch, Hu, Mu(-), Po, Rt, Xp
Applications: IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-76639
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
MEP00B
Species: Mu
Applications: ELISA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-81984
Species: Hu
Applications: IHC,  IHC-P, WB
BC100-494
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for BNIP3L Antibody (NBP2-92792) (0)

There are no publications for BNIP3L Antibody (NBP2-92792).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BNIP3L Antibody (NBP2-92792) (0)

There are no reviews for BNIP3L Antibody (NBP2-92792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BNIP3L Antibody (NBP2-92792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BNIP3L Products

Research Areas for BNIP3L Antibody (NBP2-92792)

Find related products by research area.

Blogs on BNIP3L.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BNIP3L Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol BNIP3L