Recombinant Human BMP-2 Protein

Product Discontinued

Recombinant Human BMP-2 Protein Summary

• Description: A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-100 of Human BMP2 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:AHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP

• Protein/Peptide Type: Recombinant Protein
• Gene: BMP2

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: This product is useful for WB-Re,ELISA,Array,AP.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BMP-2 Protein

• BDA2
• BMP2
• BMP-2
• BMP-2A
• BMP2ABone morphogenetic protein 2A
• bone morphogenetic protein 2
• SSFSC

Background

Bone morphogenic proteins (BMPs) are members of the TGFbeta superfamily. BMPs are involved in the induction of cartilage and bone formation. In vivo studies have shown that BMP-2 (also designated BMP-2A) and BMP-3 can independently induce cartilage formation. Smad3 association with the TGFbeta receptor complex and Smad1 translocation to the nucleus are observed after the addition of BMP-4 (also designated BMP-2B), suggesting that BMP-4 may play a role in activation of the Smad pathway. BMP-5, BMP-6 and BMP-7 all share high sequence homology with BMP-2, indicating that they each may be able to induce cartilage formation. BMP-8 (also designated OP-2) is thought to be involved in early development, as detectable expression has not been found in adult organs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for BMP-2 Recombinant Protein (H00000650-Q03). (Showing 1 - 1 of 1 FAQ).

1. I am interested in Bone Morphogenic Protein 2 (BMP-2) for clinical trial in humans. I am using this protein in stem cells culture for future use in humans. Do you have BMP-2 in pharma grade that I can use for humans?
   • Our antibodies are for research purposes only unfortunately. I am sorry we cannot be of further help.

Bioinformatics

• Gene Symbol: BMP2