BMP-2 Recombinant Protein Antigen

Images

 
There are currently no images for BMP-2 Recombinant Protein Antigen (NBP2-56251PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BMP-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BMP-2.

Source: E. coli

Amino Acid Sequence: RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BMP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56251.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BMP-2 Recombinant Protein Antigen

  • BDA2
  • BMP2
  • BMP-2
  • BMP-2A
  • BMP2ABone morphogenetic protein 2A
  • bone morphogenetic protein 2
  • SSFSC

Background

Bone morphogenic proteins (BMPs) are members of the TGFbeta superfamily. BMPs are involved in the induction of cartilage and bone formation. In vivo studies have shown that BMP-2 (also designated BMP-2A) and BMP-3 can independently induce cartilage formation. Smad3 association with the TGFbeta receptor complex and Smad1 translocation to the nucleus are observed after the addition of BMP-4 (also designated BMP-2B), suggesting that BMP-4 may play a role in activation of the Smad pathway. BMP-5, BMP-6 and BMP-7 all share high sequence homology with BMP-2, indicating that they each may be able to induce cartilage formation. BMP-8 (also designated OP-2) is thought to be involved in early development, as detectable expression has not been found in adult organs.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM
Species: Hu, Mu, Rt
Applications: BA
314-BP
Species: Hu
Applications: BA, BA
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
354-BP
Species: Hu
Applications: BA
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: WB
DCC270
Species: Hu
Applications: ELISA
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-25358
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-15742
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
NBP3-35329
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
507-BP
Species: Hu
Applications: BA
6057-NG
Species: Hu
Applications: BA
233-FB
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA

Publications for BMP-2 Recombinant Protein Antigen (NBP2-56251PEP) (0)

There are no publications for BMP-2 Recombinant Protein Antigen (NBP2-56251PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMP-2 Recombinant Protein Antigen (NBP2-56251PEP) (0)

There are no reviews for BMP-2 Recombinant Protein Antigen (NBP2-56251PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BMP-2 Recombinant Protein Antigen (NBP2-56251PEP). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in Bone Morphogenic Protein 2 (BMP-2) for clinical trial in humans. I am using this protein in stem cells culture for future use in humans. Do you have BMP-2 in pharma grade that I can use for humans?
    • Our antibodies are for research purposes only unfortunately. I am sorry we cannot be of further help.

Additional BMP-2 Products

Research Areas for BMP-2 Recombinant Protein Antigen (NBP2-56251PEP)

Find related products by research area.

Blogs on BMP-2

There are no specific blogs for BMP-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BMP-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BMP2