Blood Group B Transferase/GTB/ABO Antibody

Images

 
Western Blot: Blood Group B Transferase/GTB/ABO Antibody [NBP1-74152] - Mouse Spleen Lysate 1.0 ug/ml, gel concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Blood Group B Transferase/GTB/ABO Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Abo. Immunizing peptide sequence GVEILSTFFGTLHPGFYSSSREAFTYERRPQSQAYIPWDRGDFYYGGAFF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Abo and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Blood Group B Transferase/GTB/ABO Antibody

  • A transferase
  • A3GALNT
  • A3GALT1
  • ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase;transferase B, alpha 1-3-galactosyltransferase)
  • ABO glycosyltransferase
  • ABO
  • B transferase
  • B(A) alpha-1,3-galactosyltransferase
  • EC 2.4.1.37
  • EC 2.4.1.40
  • Fucosylglycoprotein 3-alpha-galactosyltransferase
  • Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase
  • Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
  • Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
  • GTB
  • Histo-blood group A transferase
  • histo-blood group A2 transferase
  • histo-blood group ABO system transferase
  • Histo-blood group B transferase
  • NAGAT

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07087
Species: Hu
NBP1-69668
Species: Hu
Applications: WB
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
NBP2-66881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF6457
Species: Hu
Applications: WB
NBP2-48927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC-Fr, IP
H00008846-B01P
Species: Hu
Applications: WB, ICC/IF, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-74152
Species: Mu
Applications: WB

Publications for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152) (0)

There are no publications for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152) (0)

There are no reviews for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152)

Discover related pathways, diseases and genes to Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152)

Discover more about diseases related to Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152).
 

Pathways for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152)

View related products by pathway.

PTMs for Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152)

Learn more about PTMs related to Blood Group B Transferase/GTB/ABO Antibody (NBP1-74152).

Blogs on Blood Group B Transferase/GTB/ABO

There are no specific blogs for Blood Group B Transferase/GTB/ABO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Blood Group B Transferase/GTB/ABO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABO
Uniprot