We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

BLIMP1/PRDM1 Recombinant Protein Antigen

Images

 
There are currently no images for BLIMP1/PRDM1 Recombinant Protein Antigen (NBP3-17184PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BLIMP1/PRDM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BLIMP1/PRDM1

Source: E.coli

Amino Acid Sequence: VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRDM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17184It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BLIMP1/PRDM1 Recombinant Protein Antigen

  • Beta-interferon gene positive regulatory domain I-binding factor
  • beta-interferon gene positive-regulatory domain I binding factor
  • BLIMP1
  • BLIMP-1
  • BLIMP1MGC118925
  • blmp-1
  • B-lymphocyte-induced maturation protein 1
  • MGC118922
  • MGC118923
  • Positive regulatory domain I-binding factor 1
  • PR domain containing 1, with ZNF domain
  • PR domain zinc finger protein 1
  • PR domain-containing protein 1
  • PRDI-BF1MGC118924
  • PRDI-binding factor 1
  • PRDI-binding factor-1
  • PRDM1
  • PR-domain zinc finger protein 1
  • ZNFPR1A1

Background

Blimp-1 (B lymphocyte maturation protein-1) is a transcriptional repressor that is required to trigger terminal differentiation of B lymphocytes into Ig secreting cells. Therefore, Blimp 1 is generally considered a "master regulator" for hematopoietic stem cells.

Blimp1 is a nuclear protein with five zinc fingers in its carboxy terminus. The Blimp-1 protein is expressed in, and may be required for terminally differentiated epithelial cells, retinal neurons and other lineage cells. BLIMP-1 has also been implicated in the repression of beta-interferon (IFN-beta) and c-myc gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59786
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
MAB3487
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
NBP1-77681
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF5525
Species: Hu
Applications: IHC, WB
6507-IL/CF
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-89644
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF594
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
7268-CT
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
NBP1-91011
Species: Hu
Applications: IHC, IHC-Fr,  IHC-P, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
M6000B
Species: Mu
Applications: ELISA
M5000
Species: Mu
Applications: ELISA
NBP3-17184PEP
Species: Hu
Applications: AC

Publications for BLIMP1/PRDM1 Recombinant Protein Antigen (NBP3-17184PEP) (0)

There are no publications for BLIMP1/PRDM1 Recombinant Protein Antigen (NBP3-17184PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BLIMP1/PRDM1 Recombinant Protein Antigen (NBP3-17184PEP) (0)

There are no reviews for BLIMP1/PRDM1 Recombinant Protein Antigen (NBP3-17184PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BLIMP1/PRDM1 Recombinant Protein Antigen (NBP3-17184PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BLIMP1/PRDM1 Products

Research Areas for BLIMP1/PRDM1 Recombinant Protein Antigen (NBP3-17184PEP)

Find related products by research area.

Blogs on BLIMP1/PRDM1.

Tired T cells: Hypoxia Drives T cell Exhaustion in the Tumor Microenvironment
By Hunter MartinezThe paradigm shifting view of the immune system being leveraged to target cancer has led to numerous therapeutic breakthroughs. One major cell group responsible for this revelation is a T cell. ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BLIMP1/PRDM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM1