BLIMP1/PRDM1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

BLIMP1/PRDM1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BLIMP1/PRDM1
  
  

  Source: E.coli

  Amino Acid Sequence: VGTTLAAPKCNSSTVRFQGLAEGTKGTMKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PRDM1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17184It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BLIMP1/PRDM1 Recombinant Protein Antigen

• Beta-interferon gene positive regulatory domain I-binding factor
• beta-interferon gene positive-regulatory domain I binding factor
• BLIMP1
• BLIMP-1
• BLIMP1MGC118925
• blmp-1
• B-lymphocyte-induced maturation protein 1
• MGC118922
• MGC118923
• Positive regulatory domain I-binding factor 1
• PR domain containing 1, with ZNF domain
• PR domain zinc finger protein 1
• PR domain-containing protein 1
• PRDI-BF1MGC118924
• PRDI-binding factor 1
• PRDI-binding factor-1
• PRDM1
• PR-domain zinc finger protein 1
• ZNFPR1A1

Background

Blimp-1 (B lymphocyte maturation protein-1) is a transcriptional repressor that is required to trigger terminal differentiation of B lymphocytes into Ig secreting cells. Therefore, Blimp 1 is generally considered a "master regulator" for hematopoietic stem cells.

Blimp1 is a nuclear protein with five zinc fingers in its carboxy terminus. The Blimp-1 protein is expressed in, and may be required for terminally differentiated epithelial cells, retinal neurons and other lineage cells. BLIMP-1 has also been implicated in the repression of beta-interferon (IFN-beta) and c-myc gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRDM1