BICD2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining in human skin and liver tissues using anti-BICD2 antibody. Corresponding BICD2 RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining of human liver, lymph node, skin and testis using Anti-BICD2 antibody NBP1-81488 (A) shows similar protein ...read more
Western Blot: BICD2 Antibody [NBP1-81488] - Role of BICD1 in dynein-mediated HIF1alpha nuclear translocation in UCB-MSCs. Co-immunoprecipitation of BICD1, BICD2, Dynein IC, and alpha-Tubulin with IgG and HIF1alpha ...read more
Immunocytochemistry/ Immunofluorescence: BICD2 Antibody [NBP1-81488] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining of human skin using Anti-BICD2 antibody NBP1-81488.
Western Blot: BICD2 Antibody [NBP1-81488] - Analysis in human cell line U-2197.
Western Blot: BICD2 Antibody [NBP1-81488] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Independent Antibodies: Western Blot: BICD2 Antibody [NBP1-81488] - Analysis using Anti-BICD2 antibody NBP1-81488 (A) shows similar pattern to independent antibody NBP1-81489 (B).
Western Blot: BICD2 Antibody [NBP1-81488] - Role of BICD1 in dynein-mediated HIF-1 alpha nuclear translocation in UCB-MSCs. Co-immunoprecipitation of BICD1, BICD2, Dynein IC, and alpha-Tubulin with IgG and HIF-1 alpha ...read more
Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining of human testis.
Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining of human lymph node.
Immunohistochemistry-Paraffin: BICD2 Antibody [NBP1-81488] - Staining of human liver using Anti-BICD2 antibody NBP1-81488.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BICD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BICD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BICD2 Protein (NBP1-81488PEP)
Publications
Read Publication using
NBP1-81488 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BICD2 Antibody

  • bicaudal D homolog 2 (Drosophila)
  • KIAA0699

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP1-78735
Species: Hu
Applications: IP, KD, WB
NBP1-33110
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-85277
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC, IHC-P, WB
AF1556
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
H00091754-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
H00004751-M11
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-82539
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB500-181
Species: Dr, Hu, Ma, Mu, Pl, Po, Rt
Applications: IB, ICC/IF, IP, WB
NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
NBP1-87174
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-85638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13650
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13546
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-70427
Species: Hu
Applications: WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for BICD2 Antibody (NBP1-81488)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for BICD2 Antibody (NBP1-81488) (0)

There are no reviews for BICD2 Antibody (NBP1-81488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BICD2 Antibody (NBP1-81488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BICD2 Products

Array NBP1-81488

Bioinformatics Tool for BICD2 Antibody (NBP1-81488)

Discover related pathways, diseases and genes to BICD2 Antibody (NBP1-81488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BICD2 Antibody (NBP1-81488)

Discover more about diseases related to BICD2 Antibody (NBP1-81488).
 

Pathways for BICD2 Antibody (NBP1-81488)

View related products by pathway.

PTMs for BICD2 Antibody (NBP1-81488)

Learn more about PTMs related to BICD2 Antibody (NBP1-81488).

Blogs on BICD2

There are no specific blogs for BICD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BICD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BICD2