Dynactin Subunit 2/DCTN2/DCTN-50 Antibody

Images

 
Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cell line U-2 OS shows positivity in nucleus and cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dynactin Subunit 2/DCTN2/DCTN-50 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCTN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP)
Publications
Read Publication using
NBP1-85277 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody

  • DCTN2
  • DCTN-50
  • DCTN5050 kD dynein-associated polypeptide
  • dynactin 2 (p50)
  • dynactin complex 50 kD subunit
  • Dynactin complex 50 kDa subunit
  • Dynactin Subunit 2
  • dynactin subunit 2,50 kDa dynein-associated polypeptide
  • Dynamitin
  • p50 dynamitin
  • RBP50

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15274
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-57469
Species: Hu
Applications: WB, IHC, IHC-P
AF2204
Species: Hu
Applications: WB, IHC
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85277
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277) (0)

There are no reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dynactin Subunit 2/DCTN2/DCTN-50 Products

Bioinformatics Tool for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)

Discover related pathways, diseases and genes to Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)

Discover more about diseases related to Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277).
 

Pathways for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)

View related products by pathway.

Research Areas for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)

Find related products by research area.

Blogs on Dynactin Subunit 2/DCTN2/DCTN-50

There are no specific blogs for Dynactin Subunit 2/DCTN2/DCTN-50, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dynactin Subunit 2/DCTN2/DCTN-50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCTN2
Entrez