Dynactin Subunit 2/DCTN2/DCTN-50 Antibody

Images

 
Genetic Strategies: Knockdown Validated: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Quantification of Dynactin-2 knockdown in HeLa cells by Western Blot. Western blots were cropped as indicated ...read more
Immunocytochemistry/ Immunofluorescence: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Dynactin-2 is part of the linker arm for the molecular motor Dynein. ILK and Dynactin-2 colocalize at the basal cortex ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DCTN2 antibody NBP1-85277 (A) ...read more
Independent Antibodies: Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Analysis using Anti-DCTN2 antibody NBP1-85277 (A) shows similar pattern to independent antibody NBP1-85278 (B).
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human kidney.
Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human testis.
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dynactin Subunit 2/DCTN2/DCTN-50 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCTN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF and WB reactivity reported in (PMID: 25669897).
Control Peptide
Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP)
Publications
Read Publication using
NBP1-85277 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody

  • DCTN2
  • DCTN-50
  • DCTN5050 kD dynein-associated polypeptide
  • dynactin 2 (p50)
  • dynactin complex 50 kD subunit
  • Dynactin complex 50 kDa subunit
  • Dynactin Subunit 2
  • dynactin subunit 2,50 kDa dynein-associated polypeptide
  • Dynamitin
  • p50 dynamitin
  • RBP50

Background

Dynactin subunit 2 encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
H00008518-M03
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB500-207
Species: Hu
Applications: ICC/IF, IP, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
NB100-68205
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-30463
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IP, WB
PP-H7147-00
Species: Hu
Applications: IHC, IP, WB
NBP2-14306
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15274
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88848
Species: Hu
Applications: IHC, IHC-P
AF2204
Species: Hu
Applications: IHC, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF7388
Species: Hu
Applications: IHC
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-85277
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KD

Publications for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277) (0)

There are no reviews for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dynactin Subunit 2/DCTN2/DCTN-50 Products

Bioinformatics Tool for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)

Discover related pathways, diseases and genes to Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)

Discover more about diseases related to Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277).
 

Pathways for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)

View related products by pathway.

Research Areas for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)

Find related products by research area.

Blogs on Dynactin Subunit 2/DCTN2/DCTN-50

There are no specific blogs for Dynactin Subunit 2/DCTN2/DCTN-50, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dynactin Subunit 2/DCTN2/DCTN-50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCTN2