Dynactin Subunit 2/DCTN2/DCTN-50 Antibody - BSA Free

Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Quantification of Dynactin-2 knockdown in HeLa cells by Western Blot. Western blots were cropped as indicated (black boxes). For all samples, SDS-PAGE and Western blotting were performed under the same experimental conditions. n:20 for each condition. * = p < 0.05; ** = p < 0.01. Scale bar 10 um. Error bars represent SEM. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep08389) licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Dynactin-2 is part of the linker arm for the molecular motor Dynein. ILK and Dynactin-2 colocalize at the basal cortex but not at the spindle. of a metaphase cell. Scale bar 10 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/srep08389) licensed under a CC-BY license.

Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex, colon, kidney and testis using Anti-DCTN2 antibody NBP1-85277 (A) shows similar protein distribution across tissues to independent antibody NBP1-85278 (B).

Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Analysis using Anti-DCTN2 antibody NBP1-85277 (A) shows similar pattern to independent antibody NBP1-85278 (B).

Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human kidney.

Western Blot: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human testis.

Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Dynactin Subunit 2/DCTN2/DCTN-50 Antibody [NBP1-85277] - Staining of human colon.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dynactin Subunit 2/DCTN2/DCTN-50 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DCTN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF and WB reactivity reported in (PMID: 25669897).
• Control Peptide:

  Dynactin Subunit 2/DCTN2/DCTN-50 Protein (NBP1-85277PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody - BSA Free

• DCTN2
• DCTN-50
• DCTN5050 kD dynein-associated polypeptide
• dynactin 2 (p50)
• dynactin complex 50 kD subunit
• Dynactin complex 50 kDa subunit
• Dynactin Subunit 2
• dynactin subunit 2,50 kDa dynein-associated polypeptide
• Dynamitin
• p50 dynamitin
• RBP50

Background

Dynactin subunit 2 encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dynactin Subunit 2/DCTN2/DCTN-50 Antibody (NBP1-85277)(1)

Publication using NBP1-85277

• Morris EJ, Assi K, Salh B, Dedhar S. Integrin-Linked Kinase links Dynactin-1/Dynactin-2 with cortical Integrin receptors to orient the mitotic spindle relative to the substratum Sci Rep. 2015-02-11 [PMID: 25669897] (ICC/IF, WB, Human)

Bioinformatics

• Gene Symbol: DCTN2