NEK8 Antibody - Azide and BSA Free

Images

 
Western Blot: NEK8 Antibody [NBP2-93834] - Western blot analysis of extracts of various cell lines, using NEK8 antibody (NBP2-93834) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NEK8 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 270-390 of human NEK8 (NP_835464.1). GSVRMRRAEKSVAPSNTGSRTTSVRCRGIPRGPVRPAIPPPLSSVYAWGGGLGTPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGSLLPGAVEQPQPQFISRFLEGQSG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEK8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:500
  • Western Blot 1:100 - 1:500
Theoretical MW
74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for NEK8 Antibody - Azide and BSA Free

  • EC 2.7.11
  • EC 2.7.11.1
  • JCKNIMA-related kinase 12a
  • MGC138445
  • NEK12A
  • nephrocystin 9
  • Never in mitosis A-related kinase 8
  • NIMA (never in mitosis gene a)- related kinase 8
  • Nima-related protein kinase 12a
  • NimA-related protein kinase 8
  • NPHP9NIMA-family kinase NEK8
  • serine/threonine-protein kinase Nek8
  • serine/thrionine-protein kinase NEK8

Background

NEK8 (NIMA-Related Kinase 8) belongs to the protein kinase superfamily. Mutations in NEK8 have been linked to nephronophthisis type 9. NEK8 is required for renal tubular integrity. NEK8 is known to have interactions with ABL1, FYN, ACVR1, BICD2 and CSN2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NEK8 Antibody (NBP2-93834) (0)

There are no publications for NEK8 Antibody (NBP2-93834).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK8 Antibody (NBP2-93834) (0)

There are no reviews for NEK8 Antibody (NBP2-93834). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEK8 Antibody (NBP2-93834) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK8 Products

Research Areas for NEK8 Antibody (NBP2-93834)

Find related products by research area.

Blogs on NEK8

There are no specific blogs for NEK8, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK8 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK8