ZFP37 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZFP37 Antibody [NBP2-13546] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & vesicles.

Immunohistochemistry-Paraffin: ZFP37 Antibody [NBP2-13546] - Staining of human bone marrow shows strong cytoplasmic positivity in subset of hematopoietic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZFP37 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZFP37 Antibody - BSA Free (NBP2-13546) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: MSVSSGDQILTKPETVDRRRSAETTKEAGRPLEMAVSEPEASAAEWKQLDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFP37
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZFP37 Protein (NBP2-13546PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZFP37 Antibody - BSA Free

• dJ734P14.5
• FLJ39592
• MGC10715
• MGC20504
• zinc finger protein 343

Background

ZFP37 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZFP37