NEK3 Antibody

Images

 
Western Blot: NEK3 Antibody [NBP2-13650] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: NEK3 Antibody [NBP2-13650] - Immunofluorescent staining of human cell line HEK 293 shows localization to microtubules.
Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEK3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEG FLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEK3 Protein (NBP2-13650PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEK3 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • glycogen synthase A kinase
  • HSPK 36
  • HSPK36
  • hydroxyalkyl-protein kinase
  • MGC29949
  • Never in mitosis A-related kinase 3
  • NIMA (never in mitosis gene a)-related kinase 3
  • NimA-related protein kinase 3
  • phosphorylase B kinase kinase
  • serine/threonine-protein kinase Nek3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27078
Species: Hu, Ca, Pm
Applications: WB
NBP1-42686
Species: Hu
Applications: WB (-), IHC, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-82539
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB7307
Species: Rt
Applications: WB, Flow, CyTOF-ready, Neut
H00079858-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31110
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3587
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for NEK3 Antibody (NBP2-13650) (0)

There are no publications for NEK3 Antibody (NBP2-13650).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK3 Antibody (NBP2-13650) (0)

There are no reviews for NEK3 Antibody (NBP2-13650). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEK3 Antibody (NBP2-13650) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK3 Products

Bioinformatics Tool for NEK3 Antibody (NBP2-13650)

Discover related pathways, diseases and genes to NEK3 Antibody (NBP2-13650). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK3 Antibody (NBP2-13650)

Discover more about diseases related to NEK3 Antibody (NBP2-13650).
 

Pathways for NEK3 Antibody (NBP2-13650)

View related products by pathway.

PTMs for NEK3 Antibody (NBP2-13650)

Learn more about PTMs related to NEK3 Antibody (NBP2-13650).
 

Research Areas for NEK3 Antibody (NBP2-13650)

Find related products by research area.

Blogs on NEK3

There are no specific blogs for NEK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK3