NEK3 Antibody

Western Blot: NEK3 Antibody [NBP2-13650] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: NEK3 Antibody [NBP2-13650] - Immunofluorescent staining of human cell line HEK 293 shows localization to microtubules.

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650] - Staining in human testis and pancreas tissues using anti-NEK3 antibody. Corresponding NEK3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: NEK3 Antibody [NBP2-13650] - Staining of human testis shows high expression.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NEK3 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RGGSVIKYSKNTTRKQWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEK3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NEK3 Protein (NBP2-13650PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NEK3 Antibody

• EC 2.7.11
• EC 2.7.11.1
• glycogen synthase A kinase
• HSPK 36
• HSPK36
• hydroxyalkyl-protein kinase
• MGC29949
• Never in mitosis A-related kinase 3
• NIMA (never in mitosis gene a)-related kinase 3
• NimA-related protein kinase 3
• phosphorylase B kinase kinase
• serine/threonine-protein kinase Nek3

Background

In Aspergillus nidulans, lack of the serine/threonine kinase NimA (never in mitosis A) results in cell cycle arrest in G2, while overexpression causes the premature onset of mitotic events. The protein encoded by this gene is similar in sequence to the Aspergillus nidulans protein and may therefore play a role in mitotic regulation. However, the encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. Three transcript variants have been found for this gene, but the full-length nature of only two of them has been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEK3